Gene Gene information from NCBI Gene database.
Entrez ID 5818
Gene name Nectin cell adhesion molecule 1
Gene symbol NECTIN1
Synonyms (NCBI Gene)
CD111CLPED1ED4HIgRHV1SHVECOFC7PRRPRR1PVRL1PVRRPVRR1SK-12nectin-1
Chromosome 11
Chromosome location 11q23.3
Summary This gene encodes an adhesion protein that plays a role in the organization of adherens junctions and tight junctions in epithelial and endothelial cells. The protein is a calcium(2+)-independent cell-cell adhesion molecule that belongs to the immunoglobu
SNPs SNP information provided by dbSNP.
3
SNP ID Visualize variation Clinical significance Consequence
rs104894281 C>T Pathogenic Coding sequence variant, stop gained
rs876657374 C>- Pathogenic Frameshift variant, coding sequence variant
rs878853255 ->A Pathogenic Frameshift variant, coding sequence variant
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
71
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IBA
GO:0001618 Function Virus receptor activity IDA 22146396, 25231300, 28542478, 34587223
GO:0001618 Function Virus receptor activity IEA
GO:0002089 Process Lens morphogenesis in camera-type eye IEA
GO:0002934 Process Desmosome organization IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600644 9706 ENSG00000110400
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15223
Protein name Nectin-1 (Herpes virus entry mediator C) (Herpesvirus entry mediator C) (HveC) (Herpesvirus Ig-like receptor) (HIgR) (Nectin cell adhesion molecule 1) (Poliovirus receptor-related protein 1) (CD antigen CD111)
Protein function Cell adhesion molecule that promotes cell-cell contacts and plays important roles in the development of the nervous system (PubMed:21325282). Acts by forming homophilic or heterophilic trans-dimers (PubMed:21325282). Heterophilic interactions ha
PDB 3ALP , 3SKU , 3U82 , 3U83 , 4FMF , 4MYW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 34 143 Immunoglobulin V-set domain Domain
PF08205 C2-set_2 148 237 CD80-like C2-set immunoglobulin domain Domain
PF13927 Ig_3 246 320 Domain
Sequence
MARMGLAGAAGRWWGLALGLTAFFLPGVHSQVVQVNDSMYGFIGTDVVLHCSFANPLPSV
KITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEG
VYICEFATFPTGNRESQLNLTVM
AKPTNWIEGTQAVLRAKKGQDDKVLVATCTSANGKPP
SVVSWETRLKGEAEYQEIRNPNGTVTVISRYRLVPSREAHQQSLACIVNYHMDRFKE
SLT
LNVQYEPEVTIEGFDGNWYLQRMDVKLTCKADANPPATEYHWTTLNGSLPKGVEAQNRTL
FFKGPINYSLAGTYICEATN
PIGTRSGQVEVNITEFPYTPSPPEHGRRAGPVPTAIIGGV
AGSILLVLIVVGGIVVALRRRRHTFKGDYSTKKHVYGNGYSKAGIPQHHPPMAQNLQYPD
DSDDEKKAGPLGGSSYEEEEEEEEGGGGGERKVGGPHPKYDEDAKRPYFTVDEAEARQDG
YGDRTLGYQYDPEQLDLAENMVSQNDGSFISKKEWYV
Sequence length 517
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Virion - Herpesvirus
Cell adhesion molecules
Adherens junction
Herpes simplex virus 1 infection
  Adherens junctions interactions
Nectin/Necl trans heterodimerization
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
179
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cleft lip/palate-ectodermal dysplasia syndrome Pathogenic; Likely pathogenic rs769476648, rs104894281, rs876657374, rs878853255, rs778591472, rs2135551778 RCV002267572
RCV000009531
RCV000009533
RCV000009534
RCV003984996
RCV001376126
Orofacial cleft 7 Pathogenic rs104894281 RCV000009532
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Benign; Likely benign rs150553818 RCV005901061
Clear cell carcinoma of kidney Benign; Likely benign rs150553818 RCV005901062
Colon adenocarcinoma Benign; Likely benign rs150553818 RCV005901059
Malignant tumor of esophagus Benign; Likely benign rs150553818 RCV005901060
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 19180502
Ascites Associate 28038455
Atypical Squamous Cells of the Cervix Inhibit 16879022
Breast Neoplasms Associate 20543867, 24386110
Calcinosis Cutis Stimulate 24386110
Carcinoma Adenoid Cystic Associate 23583282
Carcinoma Hepatocellular Associate 26058814
Carcinoma Squamous Cell Inhibit 16879022
Carcinoma Squamous Cell Associate 20855955
Cleft Lip Associate 22455396, 9758630