NGB (neuroglobin)

Gene

• Entrez ID: 58157
• Gene name: Neuroglobin
• Gene symbol: NGB
• Synonyms (NCBI Gene): -
• Chromosome: 14
• Chromosome location: 14q24.3
• Summary: This gene encodes an oxygen-binding protein that is distantly related to members of the globin gene family. It is highly conserved among other vertebrates. It is expressed in the central and peripheral nervous system where it may be involved in increasing

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT756133	hsa-miR-320a	Luciferase reporter assay, Western blotting, qRT-PCR	34584546
MIRT1184061	hsa-miR-1184	CLIP-seq
MIRT1184062	hsa-miR-1205	CLIP-seq
MIRT1184063	hsa-miR-1207-3p	CLIP-seq
MIRT1184064	hsa-miR-1237	CLIP-seq
MIRT1184065	hsa-miR-1248	CLIP-seq
MIRT1184066	hsa-miR-1254	CLIP-seq
MIRT1184067	hsa-miR-1301	CLIP-seq
MIRT1184068	hsa-miR-28-5p	CLIP-seq
MIRT1184069	hsa-miR-3116	CLIP-seq
MIRT1184070	hsa-miR-3127-5p	CLIP-seq
MIRT1184071	hsa-miR-3130-3p	CLIP-seq
MIRT1184072	hsa-miR-3139	CLIP-seq
MIRT1184073	hsa-miR-3150b-3p	CLIP-seq
MIRT1184074	hsa-miR-3156-3p	CLIP-seq
MIRT1184075	hsa-miR-3158-5p	CLIP-seq
MIRT1184076	hsa-miR-3200-5p	CLIP-seq
MIRT1184077	hsa-miR-34a	CLIP-seq
MIRT1184078	hsa-miR-34c-5p	CLIP-seq
MIRT1184079	hsa-miR-3664-5p	CLIP-seq
MIRT1184080	hsa-miR-378	CLIP-seq
MIRT1184081	hsa-miR-378b	CLIP-seq
MIRT1184082	hsa-miR-378c	CLIP-seq
MIRT1184083	hsa-miR-378d	CLIP-seq
MIRT1184084	hsa-miR-378e	CLIP-seq
MIRT1184085	hsa-miR-378f	CLIP-seq
MIRT1184086	hsa-miR-378h	CLIP-seq
MIRT1184087	hsa-miR-378i	CLIP-seq
MIRT1184088	hsa-miR-3918	CLIP-seq
MIRT1184089	hsa-miR-422a	CLIP-seq
MIRT1184090	hsa-miR-4301	CLIP-seq
MIRT1184091	hsa-miR-4431	CLIP-seq
MIRT1184092	hsa-miR-449a	CLIP-seq
MIRT1184093	hsa-miR-449b	CLIP-seq
MIRT1184094	hsa-miR-4522	CLIP-seq
MIRT1184095	hsa-miR-4649-3p	CLIP-seq
MIRT1184096	hsa-miR-4660	CLIP-seq
MIRT1184097	hsa-miR-4689	CLIP-seq
MIRT1184098	hsa-miR-4757-5p	CLIP-seq
MIRT1184099	hsa-miR-4761-3p	CLIP-seq
MIRT1184100	hsa-miR-4784	CLIP-seq
MIRT1184101	hsa-miR-4793-3p	CLIP-seq
MIRT1184102	hsa-miR-483-3p	CLIP-seq
MIRT1184103	hsa-miR-5047	CLIP-seq
MIRT1184104	hsa-miR-532-3p	CLIP-seq
MIRT1184105	hsa-miR-544	CLIP-seq
MIRT1184106	hsa-miR-661	CLIP-seq
MIRT1184107	hsa-miR-663b	CLIP-seq
MIRT1184108	hsa-miR-708	CLIP-seq
MIRT2053380	hsa-miR-1324	CLIP-seq
MIRT2053381	hsa-miR-3189-5p	CLIP-seq
MIRT2053382	hsa-miR-4436a	CLIP-seq
MIRT2282598	hsa-miR-3074-5p	CLIP-seq
MIRT2282599	hsa-miR-548ag	CLIP-seq
MIRT2282600	hsa-miR-548ai	CLIP-seq
MIRT2282601	hsa-miR-548m	CLIP-seq
MIRT2391534	hsa-miR-1912	CLIP-seq
MIRT2391535	hsa-miR-3184	CLIP-seq
MIRT2391536	hsa-miR-423-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IBA
GO:0005092	Function	GDP-dissociation inhibitor activity	IDA	12860983
GO:0005344	Function	Oxygen carrier activity	IBA
GO:0005344	Function	Oxygen carrier activity	IEA
GO:0005344	Function	Oxygen carrier activity	TAS	11029004
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0015671	Process	Oxygen transport	IBA
GO:0015671	Process	Oxygen transport	IEA
GO:0015671	Process	Oxygen transport	NAS	11029004
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019825	Function	Oxygen binding	IBA
GO:0019825	Function	Oxygen binding	IDA	11029004
GO:0019825	Function	Oxygen binding	IEA
GO:0020037	Function	Heme binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0071456	Process	Cellular response to hypoxia	IMP	18302932
GO:0098809	Function	Nitrite reductase activity	IDA	21296891

Other IDs

• MIM: 605304
• HGNC: 14077
• e!Ensembl: ENSG00000165553

Protein

• UniProt ID: Q9NPG2
• Protein name: Neuroglobin (Nitrite reductase) (EC 1.7.-.-)
• Protein function: Monomeric globin with a bis-histidyl six-coordinate heme-iron atom through which it can bind dioxygen, carbon monoxide and nitric oxide (PubMed:11473128, PubMed:12962627, PubMed:24699645). Could help transport oxygen and increase its availabilit
• PDB: 1OJ6, 4MPM, 7VQG, 8GRZ, 8WUB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00042	Globin	5 → 114	Globin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in brain, the strongest expression is seen in the frontal lobe, the subthalamic nucleus and the thalamus. {ECO:0000269|PubMed:11029004}.
• Sequence:

  MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPE
  FLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKC
  LGPAFTPATRAAWSQLYGAVVQAMSRGWDGE

• Sequence length: 151

Pathways

Reactome:

Intracellular oxygen transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CONOTRUNCAL HEART MALFORMATIONS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
AA amyloidosis	Associate	22467552	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	19010568	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Inhibit	27651453	★☆☆☆☆ Found in Text Mining only
Amyloid Neuropathies	Associate	19010568	★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations	Associate	21725774	★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Associate	36071494	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Associate	21725774, 39290417	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Associate	20345238	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Associate	19087291	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	27149623, 27312786, 29216269, 33924212, 34440755	★☆☆☆☆ Found in Text Mining only
Cancer Pain	Associate	37005662	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Inhibit	19154338	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Associate	21725774	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Associate	19087291, 20075359, 21725774	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Stimulate	39290417	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	37005662	★☆☆☆☆ Found in Text Mining only
Death	Associate	22467552	★☆☆☆☆ Found in Text Mining only
Glaucoma	Associate	17151062	★☆☆☆☆ Found in Text Mining only
Glioma	Associate	28410531	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Associate	19087291	★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	19087291	★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	19010568, 19154338, 21725774, 34943907	★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Associate	17151062, 19087291, 22467552, 27149623, 31882813, 39290417	★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Inhibit	20345238	★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Stimulate	21725774	★☆☆☆☆ Found in Text Mining only
Hypoxia Ischemia Brain	Associate	20075359	★☆☆☆☆ Found in Text Mining only
Infarction	Stimulate	20075359	★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Stimulate	21725774	★☆☆☆☆ Found in Text Mining only
Ischemia	Associate	28410531	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Associate	31882813	★☆☆☆☆ Found in Text Mining only
Necrosis	Inhibit	19154338	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Inhibit	37005662	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	25299774, 28410531, 29216269, 34440755, 37005662	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Associate	34943907	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Associate	28410531	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Associate	30235329	★☆☆☆☆ Found in Text Mining only
Snowflake vitreoretinal degeneration	Associate	19087291	★☆☆☆☆ Found in Text Mining only
Stroke	Associate	19087291, 39290417	★☆☆☆☆ Found in Text Mining only
Stroke	Stimulate	20075359	★☆☆☆☆ Found in Text Mining only
Stroke	Inhibit	27651453	★☆☆☆☆ Found in Text Mining only