Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	581
Gene name Gene Name - the full gene name approved by the HGNC.	BCL2 associated X, apoptosis regulator
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BAX
Synonyms (NCBI Gene) Gene synonyms aliases	BCL2L4
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer w

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs398122513	G>A	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant, intron variant
rs398122840	GGGGGGG>-,GGGGGG,GGGGGGGG	Pathogenic	Coding sequence variant, frameshift variant, non coding transcript variant, initiator codon variant, intron variant

Show/Hide all(87)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016249	hsa-miR-504-5p	qRT-PCR	20542001
MIRT019436	hsa-miR-148b-3p	Microarray	17612493
MIRT023402	hsa-miR-122-5p	Microarray	17612493
MIRT023402	hsa-miR-122-5p	Western blot	18692484
MIRT023989	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT028651	hsa-miR-30a-5p	Proteomics	18668040
MIRT044018	hsa-miR-365a-3p	CLASH	23622248
MIRT437798	hsa-miR-128-3p	Luciferase reporter assay, qRT-PCR, Western blot	23526655
MIRT438317	hsa-miR-298	Luciferase reporter assay, qRT-PCR, Western blot	26064232
MIRT438317	hsa-miR-298	Luciferase reporter assay, qRT-PCR, Western blot	26064232
MIRT044018	hsa-miR-365a-3p	Microarray, Western blot	24216611
MIRT438137	hsa-miR-766-3p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24356076
MIRT438124	hsa-miR-214-3p	Luciferase reporter assay	23408966
MIRT438124	hsa-miR-214-3p	Luciferase reporter assay	23408966
MIRT438124	hsa-miR-214-3p	Luciferase reporter assay	23408966
MIRT438124	hsa-miR-214-3p	Luciferase reporter assay	23408966
MIRT438317	hsa-miR-298	Luciferase reporter assay, qRT-PCR, Western blot	26064232
MIRT438317	hsa-miR-298	Luciferase reporter assay, qRT-PCR, Western blot	26064232
MIRT044018	hsa-miR-365a-3p	Microarray, Western blot	24216611
MIRT438137	hsa-miR-766-3p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24356076
MIRT438124	hsa-miR-214-3p	Luciferase reporter assay	23408966
MIRT438124	hsa-miR-214-3p	Luciferase reporter assay	23408966
MIRT438124	hsa-miR-214-3p	Luciferase reporter assay	23408966
MIRT438124	hsa-miR-214-3p	Luciferase reporter assay	23408966
MIRT731976	hsa-miR-7-5p	Luciferase reporter assay	27158385
MIRT731976	hsa-miR-7-5p	Luciferase reporter assay	27158385
MIRT731977	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	27610823
MIRT731977	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	27610823
MIRT732758	hsa-miR-125b-5p	Luciferase reporter assay, Western blotting	33859745
MIRT733818	hsa-miR-451b	qRT-PCR, Western blotting	33725258
MIRT734059	hsa-miR-612	qRT-PCR	33564285
MIRT035570	hsa-miR-296-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	31433907
MIRT734722	hsa-miR-216a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34164485
MIRT734925	hsa-miR-145-3p	qRT-PCR	33250681
MIRT023402	hsa-miR-122-5p	Western blotting, qRT-PCR	37771781
MIRT755544	hsa-miR-181c-5p	Western blotting, qRT-PCR	36676955
MIRT755833	hsa-miR-646	Western blotting, qRT-PCR, in vitro cullelar assays, Flow cytometry	37155307
MIRT756192	hsa-miR-223-3p	Western blotting, qRT-PCR	38155264
MIRT756318	hsa-miR-29b-1-5p	Western blotting, Immunofluorescence	38934067
MIRT756378	hsa-miR-139-5p	Western blotting	37794118
MIRT756471	hsa-miR-182-5p	qRT-PCR	38796528
MIRT816098	hsa-miR-128	CLIP-seq
MIRT816099	hsa-miR-1294	CLIP-seq
MIRT816100	hsa-miR-214	CLIP-seq
MIRT816101	hsa-miR-27a	CLIP-seq
MIRT816102	hsa-miR-27b	CLIP-seq
MIRT816103	hsa-miR-3132	CLIP-seq
MIRT816104	hsa-miR-3192	CLIP-seq
MIRT816105	hsa-miR-3619-5p	CLIP-seq
MIRT816106	hsa-miR-3689a-3p	CLIP-seq
MIRT816107	hsa-miR-3689c	CLIP-seq
MIRT816108	hsa-miR-3974	CLIP-seq
MIRT816109	hsa-miR-4291	CLIP-seq
MIRT816110	hsa-miR-4450	CLIP-seq
MIRT816111	hsa-miR-4728-5p	CLIP-seq
MIRT816112	hsa-miR-4761-5p	CLIP-seq
MIRT816113	hsa-miR-542-5p	CLIP-seq
MIRT816114	hsa-miR-761	CLIP-seq
MIRT816115	hsa-miR-922	CLIP-seq
MIRT816116	hsa-miR-1207-3p	CLIP-seq
MIRT816117	hsa-miR-3714	CLIP-seq
MIRT816118	hsa-miR-4488	CLIP-seq
MIRT816119	hsa-miR-455-3p	CLIP-seq
MIRT816120	hsa-miR-4697-5p	CLIP-seq
MIRT816121	hsa-miR-4731-5p	CLIP-seq
MIRT816122	hsa-miR-637	CLIP-seq
MIRT816123	hsa-miR-4286	CLIP-seq
MIRT816124	hsa-miR-4802-5p	CLIP-seq
MIRT2180156	hsa-miR-124	CLIP-seq
MIRT816098	hsa-miR-128	CLIP-seq
MIRT816099	hsa-miR-1294	CLIP-seq
MIRT816100	hsa-miR-214	CLIP-seq
MIRT816101	hsa-miR-27a	CLIP-seq
MIRT816102	hsa-miR-27b	CLIP-seq
MIRT816103	hsa-miR-3132	CLIP-seq
MIRT816104	hsa-miR-3192	CLIP-seq
MIRT816105	hsa-miR-3619-5p	CLIP-seq
MIRT816106	hsa-miR-3689a-3p	CLIP-seq
MIRT816107	hsa-miR-3689c	CLIP-seq
MIRT816108	hsa-miR-3974	CLIP-seq
MIRT816109	hsa-miR-4291	CLIP-seq
MIRT816111	hsa-miR-4728-5p	CLIP-seq
MIRT816112	hsa-miR-4761-5p	CLIP-seq
MIRT2180157	hsa-miR-506	CLIP-seq
MIRT816113	hsa-miR-542-5p	CLIP-seq
MIRT816114	hsa-miR-761	CLIP-seq
MIRT816115	hsa-miR-922	CLIP-seq

Transcription factors

Show/Hide all(29)

Transcription factor	Regulation	Reference
AATF	Repression	22909821
ABL1	Activation	11753601
ATM	Activation	16214353
DMAP1	Unknown	24559687
ELL	Repression	15851483
ERCC2	Activation	22387547
ETS1	Repression	17213822
GFI1	Repression	17213822
HIF1A	Activation	15706354
ING1	Activation	15662138;16325212
ING4	Activation	20707719
MLLT10	Repression	15851483
MLLT3	Repression	15851483
MYCN	Activation	19885598
NFKB1	Repression	18158998
NFKB1	Unknown	20056115
NR3C1	Activation	17496926
PAX5	Activation	22105368
PER1	Repression	19675098
PML	Activation	16007146
RELA	Repression	18158998
RELA	Unknown	20056115
SP1	Unknown	11278953
STAT1	Unknown	17346710
TP53	Activation	10101800;10566557;15851483;17280505;17693666;18172861;20673369;22532570;22732402;9000137
TP53	Unknown	10559267;11278953;12851404;15988033;19067706;21859835
TP63	Activation	16007146
TP73	Unknown	19067706
WWTR1	Activation	22470139

Show/Hide all(129)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0001777	Process	T cell homeostatic proliferation	IEA
GO:0001782	Process	B cell homeostasis	IEA
GO:0001783	Process	B cell apoptotic process	IDA	15214043, 16424160
GO:0001822	Process	Kidney development	IEA
GO:0001836	Process	Release of cytochrome c from mitochondria	IBA	21873635
GO:0001836	Process	Release of cytochrome c from mitochondria	IDA	9843949, 16199525, 17052454, 25609812
GO:0001844	Process	Protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS
GO:0001974	Process	Blood vessel remodeling	IEA
GO:0002262	Process	Myeloid cell homeostasis	IEA
GO:0002352	Process	B cell negative selection	IEA
GO:0002358	Process	B cell homeostatic proliferation	IEA
GO:0002904	Process	Positive regulation of B cell apoptotic process	IEA
GO:0005515	Function	Protein binding	IPI	9027312, 9111042, 9388232, 9463381, 9843949, 10753914, 11161816, 11278245, 11571294, 11574543, 12732850, 12925958, 14730312, 14752512, 14963330, 15205477, 15901672, 16113678, 16151013, 16439990, 16509771, 16608847, 16645094, 17123957, 17289999, 17485524, 17525735, 17606912, 17635912
GO:0005634	Component	Nucleus	IDA	12925958
GO:0005634	Component	Nucleus	IMP	15102863
GO:0005635	Component	Nuclear envelope	IDA	12925958
GO:0005737	Component	Cytoplasm	IDA	16302269, 29531808
GO:0005739	Component	Mitochondrion	IDA	11912183, 15102863, 15705586, 16199525, 17823127, 19767770, 25609812
GO:0005741	Component	Mitochondrial outer membrane	IBA	21873635
GO:0005741	Component	Mitochondrial outer membrane	IDA	29531808
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005757	Component	Mitochondrial permeability transition pore complex	IDA	9843949
GO:0005783	Component	Endoplasmic reticulum	IDA	16424160
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	16424160
GO:0005829	Component	Cytosol	IDA	11912183, 12925958, 15102863, 15705586, 17823127, 19767770
GO:0005829	Component	Cytosol	TAS
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	TAS
GO:0006687	Process	Glycosphingolipid metabolic process	IEA
GO:0006808	Process	Regulation of nitrogen utilization	IEA
GO:0006915	Process	Apoptotic process	IDA	9660918, 17428862
GO:0006915	Process	Apoptotic process	IMP	9531611
GO:0006915	Process	Apoptotic process	NAS	9920818
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	11912183
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	11350920
GO:0006977	Process	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS
GO:0007281	Process	Germ cell development	IEA
GO:0008053	Process	Mitochondrial fusion	IBA	21873635
GO:0008053	Process	Mitochondrial fusion	IDA	14769861
GO:0008289	Function	Lipid binding	IDA	14522999
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IC	16199525
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IBA	21873635
GO:0008635	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	IDA	15214043
GO:0008637	Process	Apoptotic mitochondrial changes	IDA	9843949
GO:0009566	Process	Fertilization	IEA
GO:0009636	Process	Response to toxic substance	IDA	16307838
GO:0009651	Process	Response to salt stress	IEA
GO:0010248	Process	Establishment or maintenance of transmembrane electrochemical gradient	IDA	9843949
GO:0010332	Process	Response to gamma radiation	IEA
GO:0010917	Process	Negative regulation of mitochondrial membrane potential	IDA	16751333
GO:0015267	Function	Channel activity	IBA	21873635
GO:0015267	Function	Channel activity	IDA	9219694
GO:0016020	Component	Membrane	HDA	19946888
GO:0016032	Process	Viral process	IEA
GO:0021854	Process	Hypothalamus development	IEA
GO:0021987	Process	Cerebral cortex development	IEA
GO:0030544	Function	Hsp70 protein binding	IEA
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	9111042, 19805544
GO:0032091	Process	Negative regulation of protein binding	IDA	9388232
GO:0032469	Process	Endoplasmic reticulum calcium ion homeostasis	TAS	18309324
GO:0032471	Process	Negative regulation of endoplasmic reticulum calcium ion concentration	IEA
GO:0032976	Process	Release of matrix enzymes from mitochondria	IDA	9843949
GO:0033137	Process	Negative regulation of peptidyl-serine phosphorylation	IEA
GO:0033599	Process	Regulation of mammary gland epithelial cell proliferation	IEA
GO:0034620	Process	Cellular response to unfolded protein	TAS	22013210
GO:0034644	Process	Cellular response to UV	IEA
GO:0035234	Process	Ectopic germ cell programmed cell death	IEA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0042802	Function	Identical protein binding	IPI	10620504, 14963330, 16113678, 17024184, 17289999, 17668322, 18547146, 18835031, 19062087, 19074440, 19767770, 20360684, 20541605, 20850011, 22198199, 23374347
GO:0042803	Function	Protein homodimerization activity	IBA	21873635
GO:0042803	Function	Protein homodimerization activity	IDA	16608847
GO:0042981	Process	Regulation of apoptotic process	IDA	25609812
GO:0042981	Process	Regulation of apoptotic process	TAS
GO:0043065	Process	Positive regulation of apoptotic process	IBA	21873635
GO:0043065	Process	Positive regulation of apoptotic process	IDA	16751333, 17464193
GO:0043065	Process	Positive regulation of apoptotic process	IMP	17289999
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IDA	15637643
GO:0043653	Process	Mitochondrial fragmentation involved in apoptotic process	IDA	12499352
GO:0045136	Process	Development of secondary sexual characteristics	IEA
GO:0046666	Process	Retinal cell programmed cell death	IEA
GO:0046930	Component	Pore complex	IDA	9219694
GO:0046982	Function	Protein heterodimerization activity	IBA	21873635
GO:0046982	Function	Protein heterodimerization activity	IPI	9111042
GO:0048087	Process	Positive regulation of developmental pigmentation	IEA
GO:0048147	Process	Negative regulation of fibroblast proliferation	IEA
GO:0048515	Process	Spermatid differentiation	IEA
GO:0048597	Process	Post-embryonic camera-type eye morphogenesis	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0051087	Function	Chaperone binding	IEA
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051434	Function	BH3 domain binding	IDA	21199865
GO:0051434	Function	BH3 domain binding	IPI	15705586, 17052454
GO:0051881	Process	Regulation of mitochondrial membrane potential	IDA	9843949
GO:0060011	Process	Sertoli cell proliferation	IEA
GO:0060041	Process	Retina development in camera-type eye	IEA
GO:0060058	Process	Positive regulation of apoptotic process involved in mammary gland involution	IEA
GO:0060068	Process	Vagina development	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IMP	16645094
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	22934019
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070242	Process	Thymocyte apoptotic process	IEA
GO:0070584	Process	Mitochondrion morphogenesis	IEA
GO:0071944	Component	Cell periphery	IDA	21803450
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IEA
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IDA	14963330
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IMP	21262771
GO:0097136	Component	Bcl-2 family protein complex	IDA	21199865
GO:0097144	Component	BAX complex	IDA	14522999, 17024184, 19074440, 19767770, 20541605, 20850011
GO:0097145	Component	BAK complex	IDA	16113678
GO:0097190	Process	Apoptotic signaling pathway	IDA	16424160
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	15214043
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IBA	21873635
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IDA	9219694, 16462759
GO:0097296	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IEA
GO:0098586	Process	Cellular response to virus	IDA	25609812
GO:1900103	Process	Positive regulation of endoplasmic reticulum unfolded protein response	IMP	16645094
GO:1901030	Process	Positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	TAS
GO:1902262	Process	Apoptotic process involved in blood vessel morphogenesis	IEA
GO:1902263	Process	Apoptotic process involved in embryonic digit morphogenesis	IEA
GO:1902445	Process	Regulation of mitochondrial membrane permeability involved in programmed necrotic cell death	IEA
GO:1902512	Process	Positive regulation of apoptotic DNA fragmentation	IMP	11350920
GO:1903896	Process	Positive regulation of IRE1-mediated unfolded protein response	TAS	22013210
GO:1990117	Process	B cell receptor apoptotic signaling pathway	IDA	15214043
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IEA
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IMP	14963330, 21199865, 21262771

MIM	HGNC	e!Ensembl
600040	959	ENSG00000087088

Protein

UniProt ID

Q07812

Protein name

Apoptosis regulator BAX (Bcl-2-like protein 4) (Bcl2-L-4)

Protein function

Plays a role in the mitochondrial apoptotic process (PubMed:10772918, PubMed:11060313, PubMed:16113678, PubMed:16199525, PubMed:18948948, PubMed:21199865, PubMed:21458670, PubMed:25609812, PubMed:36361894, PubMed:8358790, PubMed:8521816). Under

PDB

1F16 , 2G5B , 2K7W , 2LR1 , 3PK1 , 3PL7 , 4BD2 , 4BD6 , 4BD7 , 4BD8 , 4BDU , 4S0O , 4S0P , 4UF2 , 4ZIE , 4ZIF , 4ZIG , 4ZIH , 4ZII , 5W5X , 5W5Z , 5W60 , 5W61 , 6EB6 , 6L8V , 6L95 , 6TRR , 6XY6 , 7ADT , 8G1T , 8SPE , 8SPF , 8SPZ , 8SRX , 8SRY , 8SVK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00452	Bcl-2	63 → 158	Apoptosis regulator proteins, Bcl-2 family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breas

Sequence

MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG

Sequence length

192

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance Endocrine resistance Platinum drug resistance Sphingolipid signaling pathway p53 signaling pathway Protein processing in endoplasmic reticulum Apoptosis Longevity regulating pathway Apoptosis - multiple species Necroptosis Neurotrophin signaling pathway Non-alcoholic fatty liver disease AGE-RAGE signaling pathway in diabetic complications Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Pathogenic Escherichia coli infection Shigellosis Salmonella infection Tuberculosis Hepatitis C Hepatitis B Measles Human cytomegalovirus infection Influenza A Human papillomavirus infection Human T-cell leukemia virus 1 infection Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Pathways in cancer Transcriptional misregulation in cancer Viral carcinogenesis Colorectal cancer Pancreatic cancer Endometrial cancer Glioma Thyroid cancer Basal cell carcinoma Melanoma Chronic myeloid leukemia Small cell lung cancer Non-small cell lung cancer Breast cancer Hepatocellular carcinoma Gastric cancer Lipid and atherosclerosis		Release of apoptotic factors from the mitochondria Activation, translocation and oligomerization of BAX TP53 Regulates Transcription of Genes Involved in Cytochrome C Release TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest Transcriptional regulation by RUNX2

Show/Hide Causal Diseases (11)

Disease term	Disease name	dbSNP ID	References
Causal
Alzheimer disease	Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039 View all (65 more)	18077176
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	22572619
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	22572619
Burkitt`s lymphoma	Burkitt Lymphoma	rs28933407, rs121918683, rs121918684
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	17404573
Colorectal cancer	Colorectal Carcinoma, Adenocarcinoma of large intestine	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)
Esophagus neoplasm	Esophageal Neoplasms, Malignant neoplasm of esophagus	rs28934578, rs121918714, rs1567556006, rs1575166666	17634542
Lymphoma	Lymphoma, T-Cell, Cutaneous	rs11540652, rs1592119138, rs1592123162, rs1599367044	12754746
Lymphoblastic leukemia	Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	rs387906351, rs104894562, rs398122513, rs398122840, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699 View all (13 more)
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	22572619
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17542986

Show/Hide Unknown Diseases (3)

Disease term	Disease name	References	Source
Unknown
Myocardial infarction	Myocardial Infarction	25450231, 20079142	ClinVar
Leukemia	leukemia, acute lymphocytic, susceptibility to, 1		GenCC
Asthma	Asthma		GWAS

Show/Hide Text Mining Associations (385)

Disease Name	Relationship Type	References
Associations from Text Mining
AA amyloidosis	Associate	31695369
Abortion Habitual	Stimulate	18019411
Abortion Habitual	Associate	30937706
Acute Coronary Syndrome	Associate	25527700
Adenocarcinoma	Associate	11005569, 14716828, 17091766, 17354623
Adenocarcinoma of Lung	Associate	23991130, 27878984, 31432162, 32667124, 38182570
Adenoma	Associate	15188026, 34762658
Adenoma	Inhibit	17109495
Adenoma Pleomorphic	Associate	25230790
Adenomatous Polyps	Associate	17278192
Aicardi Goutieres syndrome	Associate	30597845
Alzheimer Disease	Associate	19189048, 32794578, 39516502
Alzheimer Disease	Stimulate	8922409
Ameloblastoma	Associate	22207432, 25866434
Amyloidosis	Associate	19189048
Anemia Aplastic	Stimulate	33586472
Anemia Hemolytic	Stimulate	17635522
Anemia Refractory	Associate	11090080
Anemia Sickle Cell	Associate	35843474
Anodontia	Associate	16380996
Aortic Aneurysm Thoracic	Stimulate	22978789
Arthritis	Stimulate	36982526
Arthritis Rheumatoid	Inhibit	14691302, 23421940, 37506143
Arthritis Rheumatoid	Associate	24920239, 30352835, 32584515, 35904110
Asthma	Associate	11866006, 19610265
Asthma	Inhibit	18390829
Atresia of small intestine	Associate	19729672
Atrial Fibrillation	Associate	27141955
Atrial Fibrillation	Stimulate	34957910
Atypical Hemolytic Uremic Syndrome	Stimulate	23805250
Autoimmune Lymphoproliferative Syndrome	Associate	17218385, 23443079
Bacterial Infections	Associate	11462023
Balkan Nephropathy	Associate	22125429
Biliary Atresia	Associate	14606101
Biliary Tract Neoplasms	Associate	14606101
Bipolar Disorder	Associate	19945534, 29463875
Blast Injuries	Associate	28323898
Brain Injuries Diffuse	Associate	9327733
Brain Ischemia	Associate	23666460
Brain Neoplasms	Associate	10933058
Breast Carcinoma In Situ	Associate	12743423
Breast Neoplasms	Associate	10998426, 11025483, 11852106, 12210599, 12743423, 15310398, 17121430, 19035283, 19242108, 20164027, 21377101, 21861179, 22126498, 23098483, 23222814 View all (37 more)
Breast Neoplasms	Inhibit	20829044, 39732179
Breast Neoplasms	Stimulate	34360714
Calcifying Epithelial Odontogenic Tumor	Associate	29476674
Calcinosis Cutis	Associate	33202207
Cap Myopathy	Associate	16827116
Car Factor Deficiency	Associate	12172574
Carcinogenesis	Associate	10934138, 17694953, 18240345, 19118032, 19820113, 24122668, 9849580
Carcinoid Tumor	Associate	30941978, 8952529
Carcinoma	Associate	19683979
Carcinoma Ductal	Associate	11173657
Carcinoma Ductal Breast	Associate	11173657
Carcinoma Giant Cell	Associate	21706237
Carcinoma Hepatocellular	Associate	12439925, 15052673, 15962362, 17695528, 17997990, 18023099, 19360919, 22928777, 23443079, 24223706, 24287949, 24708487, 25261655, 25855960, 26044564 View all (13 more)
Carcinoma Intraductal Noninfiltrating	Associate	11173657, 18837981
Carcinoma Large Cell	Associate	8952529
Carcinoma Non Small Cell Lung	Associate	10070896, 10487853, 11843312, 15073856, 15642728, 15767261, 16410245, 17091766, 18772168, 22438908, 23082969, 23900080, 24083709, 24444609, 24695377 View all (10 more)
Carcinoma Non Small Cell Lung	Stimulate	28855578
Carcinoma Ovarian Epithelial	Associate	11720475
Carcinoma Pancreatic Ductal	Associate	24423239, 29409480
Carcinoma Renal Cell	Associate	15941683, 19609102, 27834342, 28154184, 31081053, 31259714, 32009115
Carcinoma Renal Cell	Stimulate	19563663
Carcinoma Squamous Cell	Associate	10933063, 11932899, 17694953, 28556798, 32188965, 9662258
Carcinoma Transitional Cell	Associate	12592374
Cardiac Tamponade	Associate	26956740
Cardiomyopathies	Associate	12907417
Cardiomyopathy Dilated	Stimulate	10841223
Cardiomyopathy Hypertrophic	Associate	16405608
Cerebral Amyloid Angiopathy Familial	Associate	19189048
Cholangiocarcinoma	Associate	15484294, 17067385, 22429346, 30880771, 35307646, 35790790
Chondrosarcoma	Associate	20127255, 28522217
Chromosomal Instability	Associate	18556456
Chronic Disease	Stimulate	21262580
Chronobiology Disorders	Associate	21418516
Cognitive Dysfunction	Associate	33447019
Colitis Ulcerative	Inhibit	10896914, 31159239
Colitis Ulcerative	Associate	15292938, 32022398, 35185383
Colonic Neoplasms	Associate	15955446
Colonic Neoplasms	Inhibit	31432981
Colorectal Neoplasms	Associate	10193519, 10641488, 11123425, 11514566, 11896073, 12057899, 12670866, 15770735, 15955446, 16608847, 17278192, 17373735, 17426704, 18430410, 19177010 View all (43 more)
Colorectal Neoplasms	Inhibit	32022398
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	9777938, 9849580
Common Variable Immunodeficiency	Associate	30464201
Continuous Muscle Fiber Activity Hereditary	Associate	11570908
Corneal dystrophy Avellino type	Associate	19497990
Coronary Disease	Associate	30681575
Coronavirus Infections	Associate	34281182
COVID 19	Stimulate	34076792
COVID 19	Associate	35321977
Craniosynostoses	Stimulate	29847820
Crohn Disease	Associate	11413108
Crohn Disease	Stimulate	31159239
Crystal Arthropathies	Stimulate	36982526
Cystic medial necrosis of aorta	Associate	10455077
Cysts	Associate	20210794, 24127964
Death	Associate	25243868
Depressive Disorder	Associate	11714446
Dermatitis Atopic	Associate	11091268
Dermatitis Herpetiformis	Stimulate	16388717
Dermatitis Phototoxic	Stimulate	20374575
Diabetes Mellitus	Associate	10702418, 18019411, 20200776, 26782377, 34512554
Diabetes Mellitus	Inhibit	31811564
Diabetes Mellitus Type 2	Associate	20200776, 30598071
Diabetes Mellitus Type 2	Stimulate	24030399, 30593206
Diabetic Foot	Associate	34293021
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	16254104
Diarrhea 5 With Tufting Enteropathy Congenital	Stimulate	19325208
Disease	Associate	17184597
Drug Related Side Effects and Adverse Reactions	Stimulate	10803919, 18657225, 25061298, 32862611, 34360714
Drug Related Side Effects and Adverse Reactions	Associate	11815632, 12161185, 15310398, 17603632, 17900801, 18375382, 19189048, 28272349, 30371113, 31251836, 31417251, 38179774, 9743306
Emphysematous Cholecystitis	Associate	15684288
Endometrial Hyperplasia	Associate	9849574
Endometrial Neoplasms	Inhibit	12237915
Endometrial Neoplasms	Associate	15471875, 19846939, 21888833, 29560769, 30628640, 40243844, 9849574
Endometriosis	Associate	11020520, 16150151, 24127964, 33817715, 34746304
Enterocolitis Necrotizing	Associate	27164337, 29276042
Epilepsies Myoclonic	Stimulate	22152093
Epilepsy	Associate	15057301
Epstein Barr Virus Infections	Associate	18240345
Esophageal Neoplasms	Associate	12632486, 27863415, 29136005, 32360515, 32426838
Esophageal Squamous Cell Carcinoma	Associate	22477709, 24474449, 32071920, 35601150, 36474162
Esophageal Squamous Cell Carcinoma	Inhibit	24474449
Fallopian Tube Diseases	Associate	34746304
Familial cylindromatosis	Stimulate	32901872
Familial Primary Pulmonary Hypertension	Stimulate	31336611
Fatty Liver	Associate	17036395, 25400762
Fetal Growth Retardation	Associate	21810232, 25271252
Fever	Stimulate	24728004, 31450899
Fibrocartilaginous embolism	Associate	30936926, 33413477, 33734570
Fibrosis	Stimulate	22928777
Frontotemporal Dementia	Associate	32727073
Gallbladder Neoplasms	Associate	29513793, 34118139
Gastrointestinal Stromal Tumors	Associate	16830365
Gerstmann Straussler Scheinker Disease	Associate	19680558
Gingival Neoplasms	Associate	24972848
Glioblastoma	Associate	18260157, 27932423, 30562758, 31870319, 34784707, 36235203, 36838582, 38016363, 9826721
Glioblastoma	Inhibit	30446901
Glioma	Associate	10744043, 16319070, 18445700, 19208740, 19289490, 21122152, 21364627, 21364665, 22393246, 22895663, 23684856, 25532840, 25556484, 26339341, 26743778 View all (13 more)
Glioma	Inhibit	30225541
Glomerulonephritis IGA	Inhibit	26460503, 29137483
Glomerulosclerosis Focal Segmental	Inhibit	29137483
Graves Disease	Associate	19008632
Graves Ophthalmopathy	Inhibit	39619202
HAIR AN syndrome	Stimulate	12496485
Haspeslagh Fryns Muelenaere syndrome	Associate	10655200
Head and Neck Neoplasms	Associate	23479508
Heart Failure	Associate	25961010, 38241555
Heart Failure	Stimulate	30968846
Helicobacter Infections	Associate	14716828
Helicobacter Infections	Stimulate	16270406
Hemangioma	Associate	29767244
Hematologic Diseases	Stimulate	30464201
Hepatitis Chronic	Stimulate	15457575
Hepatomegaly	Associate	17364991
Hereditary leiomyomatosis and renal cell cancer	Associate	16960154, 8630413
Hippocampal Sclerosis	Associate	12790890
HIV Infections	Inhibit	31719184
Hodgkin Disease	Associate	8630413
Hyperoxia	Stimulate	21128858
Hyperparathyroidism	Associate	10652020, 15188026
Hyperphosphatemia	Inhibit	21858050
Hyperplasia	Associate	14767488, 15188026
Hypertension	Associate	19895710, 28596595, 33973418, 9576088
Hypertension Pulmonary	Inhibit	11139485
Hypophosphatemia	Stimulate	21858050
Hypothermia	Inhibit	19596001
Hypoxia	Associate	10933058, 20164027, 30876462, 34435647
Hypoxia	Stimulate	14961987, 22815878, 30739528, 32271447, 33174051, 38285930
Hypoxia	Inhibit	24008660, 30949212
Hypoxia Brain	Associate	17201910, 22457823
Hypoxia Brain	Inhibit	36401373
Hypoxia Ischemia Brain	Stimulate	34098747
Hypoxia Ischemia Brain	Associate	35170135
Idiopathic Pulmonary Fibrosis	Stimulate	15917407
Idiopathic Pulmonary Fibrosis	Associate	18635891, 20451601
Immunoglobulin G4 Related Disease	Associate	25991504
Infarction	Associate	24096875
Infections	Associate	11462023
Infections	Stimulate	23805250
Infections	Inhibit	40302074
Infertility Male	Stimulate	26056927
Inflammation	Associate	10557320, 11570908, 24987732, 30374881, 32022398, 35848968, 37506143, 37737195, 38218927, 40252899
Inflammatory Bowel Diseases	Associate	31159239
Intervertebral Disc Degeneration	Associate	27593829, 33413477, 38041088
Intervertebral Disc Degeneration	Stimulate	33090383
Intestinal Diseases	Associate	16270406
Intestinal Neoplasms	Associate	15655830
Iron Deficiencies	Inhibit	37087978
Keratosis Actinic	Associate	16405608
Keratosis Actinic	Stimulate	22389437
Kidney Neoplasms	Associate	31424686
Klatskin Tumor	Associate	24934361
Laryngeal Neoplasms	Associate	15928664, 34268937, 35756421
Laryngeal Web Familial	Associate	9662258
Leiomyoma	Associate	28483502
Leukemia	Associate	11877295, 17364991, 19773546, 20401760, 21818379, 25867342, 32862612
Leukemia	Stimulate	30934922
Leukemia Hairy Cell	Associate	8686741
Leukemia Lymphocytic Chronic B Cell	Associate	10086798, 10583267, 12210808, 12644019, 14695629, 15802533, 16501812, 18160666, 18160669, 18945750, 20499237, 21697278, 21761401, 22898870, 32581054, 9108402, 9328155, 9558396 View all (3 more)
Leukemia Lymphoma Adult T Cell	Associate	37102641, 37832654
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	12406906, 20401760, 20704577, 26956626, 27832139
Leukemia Myeloid	Associate	15642706
Leukemia Myeloid Acute	Associate	18160664, 19463775, 23996484, 24620954, 25957891, 26801919, 37078709, 38085150, 39570105, 8916965
Leukemia Prolymphocytic T Cell	Associate	10086798, 12890741, 20813004, 22898870, 9328155
Leukemia Promyelocytic Acute	Associate	20164150, 36098742
Leukemia T Cell	Associate	14687023
Leukopenia	Associate	33280276
Leydig Cell Tumor	Associate	38387140
Lichen Planus Oral	Associate	19325208
Liver Failure	Inhibit	28876364
Liver Neoplasms	Associate	35562678
Long QT Syndrome	Associate	30628647
Lung Diseases	Associate	30941978
Lung Diseases Interstitial	Stimulate	15917407
Lung Neoplasms	Associate	10063313, 11123426, 12161185, 16679323, 17091766, 22393947, 24728004, 26134408, 26491047, 30078010, 32069989, 36128561, 37984526, 38554387
Lupus Erythematosus Discoid	Associate	26261624
Lupus Erythematosus Systemic	Associate	11905854, 26617807
Lupus Erythematosus Systemic	Stimulate	18507053
Lupus Erythematosus Systemic	Inhibit	9822266
Lupus Nephritis	Associate	11905854
Lymphatic Metastasis	Associate	17242701, 17477770, 20430737
Lymphedema Hereditary IB	Associate	12210808
Lymphoma	Associate	9376600
Lymphoma Follicular	Associate	12210808, 14767488, 37824846
Lymphoma Large B Cell Diffuse	Associate	12749011, 15073604, 15517919, 26093086, 31601689
Lymphoma Large Cell Anaplastic	Associate	11485911, 22365399, 8686741
Lymphoma Mantle Cell	Associate	28035065
Lymphoma Non Hodgkin	Associate	19048401, 8686741, 9376600, 9591044
Lymphoma Primary Effusion	Associate	36416587
Lymphoma T Cell	Associate	28950914, 37160920
Lymphoma T Cell Cutaneous	Associate	16219794
Malformations of Cortical Development Group I	Associate	11031081, 19261878, 20476668, 22052011, 23193212, 26025363, 28824303, 29070760, 31646584, 32125086, 34547186, 36973772, 9354939
Malformations of Cortical Development Group I	Stimulate	12867423
Malnutrition	Associate	21818634
Medulloblastoma	Associate	9060818, 9826721
Melanoma	Associate	11511312, 11676832, 16528364, 16702969, 17086378, 17263886, 20357812, 22277029, 22685558, 23348591, 23527236, 25735374, 32054850, 33558564, 36674631
Melanoma	Inhibit	33202207
Melanoma	Stimulate	38166464
Meningioma	Associate	26240495
Mesothelioma	Associate	12606823, 28602541, 31670317
Mesothelioma Malignant	Associate	12063468, 12606823
Metabolic Syndrome	Stimulate	23298496
Metaplasia	Associate	18390829
Microsatellite Instability	Associate	10666234, 12655021, 19820113, 20565851, 20979647, 9777938, 9849580
Mitochondrial Diseases	Stimulate	11751859, 12644018, 16778220, 28441753
Mitochondrial Diseases	Associate	12153473, 15175350, 17218385, 18331646, 18375382, 18566329, 19331169, 20393480, 20404718, 22429346, 22761775, 23108666, 23254292, 23900080, 24602180 View all (20 more)
Mitochondrial Diseases	Inhibit	29516570, 35447090
Mouth Diseases	Associate	12172574, 24127964, 34762658
Mouth Neoplasms	Associate	12172574, 23324604, 29332355
Mucocutaneous Lymph Node Syndrome	Associate	11703382
Mucocutaneous Lymph Node Syndrome	Stimulate	37506144
Multiple Myeloma	Associate	19362737, 21565982, 32173687, 38096363, 9163609
Multiple Sclerosis	Associate	28008595
Muscular Disorders Atrophic	Stimulate	16405608
Muscular Dystrophy Duchenne	Stimulate	20476668
Myasthenia Gravis	Associate	17354625
Myelodysplastic Syndromes	Associate	11090080, 15755901, 26398525, 27665715, 9886323
Myocardial Ischemia	Stimulate	10841223
Myopathy with Giant Abnormal Mitochondria	Stimulate	34470980
Myositis Inclusion Body	Associate	11570908
Myotonic Dystrophy	Inhibit	31811564
Nasopharyngeal Carcinoma	Associate	23777485, 24961145, 25227792, 25337187, 29991129, 34224316, 38009194
Necrosis	Associate	11414470
Necrosis	Stimulate	17635522
Neoplasm Invasiveness	Associate	14606101
Neoplasm Metastasis	Associate	20164027, 29845265, 37689301
Neoplasms	Associate	10193519, 10487853, 10559267, 10641488, 10666234, 10725400, 11025483, 11123425, 11226415, 11237386, 11278953, 11437412, 11437923, 11486001, 11687624 View all (127 more)
Neoplasms	Stimulate	11485911
Neoplasms	Inhibit	12172574, 16344548, 21233848, 23382965, 24122668, 24474449, 25561801, 29779937, 31432981
Neoplasms Germ Cell and Embryonal	Associate	31744479
Neoplasms Radiation Induced	Inhibit	33380655
Neoplasms Squamous Cell	Associate	16011306, 17091766, 22852863, 23633919, 24972848, 31257524
Nerve Degeneration	Associate	11815632, 39516502
Neuralgia	Associate	19128509
Neuroblastoma	Associate	17603632, 21847364, 23161404, 23223795, 27488115, 31362335, 9099968
Neurodegenerative Diseases	Associate	27630059, 32794578, 33558564
Neuroendocrine Tumors	Associate	15072592, 8952529
NOG Related Symphalangism Spectrum Disorder	Associate	16380996
Non alcoholic Fatty Liver Disease	Associate	17036395
Obesity	Inhibit	24073224
Odontogenic Cysts	Associate	22207432
Osteoarthritis	Inhibit	23421940
Osteoarthritis	Stimulate	30993110
Osteoglophonic dwarfism	Stimulate	31251836, 35609324, 36372373
Osteomyelitis	Associate	17438390
Osteosarcoma	Associate	10641488, 18223689, 24570183, 24961347, 25677904, 26569226, 30747353, 31337976, 31433581, 32922188, 33097010, 33378012, 33960434, 35758024
Osteosarcoma	Inhibit	33797312
Ovarian Diseases	Associate	25510701
Ovarian Neoplasms	Associate	10679744, 11720475, 12644821, 18657225, 22052903, 22995373, 23345014, 25095978, 26514477, 28326515, 28440479, 28731164, 29987135, 31424650, 31983100 View all (4 more)
Ovarian Neoplasms	Stimulate	12036450
Ovarian Neoplasms	Inhibit	36849137
Pancreatic Neoplasms	Associate	11694525, 15884114, 21720559, 21931488, 22119988, 23954445, 25880226, 30400136, 31799654, 31856624, 9863489
Pancreatitis Chronic	Associate	11889077
Papillary Thyroid Microcarcinoma	Associate	19683979
Papillomavirus Infections	Associate	10393359
Paraganglioma	Associate	12067490
Parathyroid Neoplasms	Associate	22198862
Parkinson Disease	Associate	11031081, 32794578
Pelvic Organ Prolapse	Associate	21674599, 29230415
Pemphigoid Bullous	Stimulate	16388717
Penile Induration	Associate	25197653
Periodontitis	Associate	30593206
Pituitary Neoplasms	Inhibit	10079254
Pituitary Neoplasms	Associate	23334699
Plaque Atherosclerotic	Associate	34513076
Polycystic Ovary Syndrome	Inhibit	26868993, 33287836
Polycystic Ovary Syndrome	Associate	30592281, 35393909
Polycystic Ovary Syndrome	Stimulate	35288480
Post Infectious Disorders	Associate	22303462
Pre Eclampsia	Stimulate	21810232
Pre Eclampsia	Associate	22837649, 31477211
Precancerous Conditions	Associate	16270406
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	10194447, 17364991, 9108419
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11091199, 16281935, 20148885, 37838759
Prediabetic State	Inhibit	35237235
Preeclamptic toxemia	Stimulate	18019411
Primary Myelofibrosis	Inhibit	22300941
Prion Diseases	Associate	19680558
Prolapse	Stimulate	21674599
Prostatic Hyperplasia	Associate	16309180, 16827116, 37378942
Prostatic Intraepithelial Neoplasia	Associate	32341393
Prostatic Neoplasms	Associate	10725400, 10952781, 12170776, 16479009, 16794010, 16814949, 16880611, 17513609, 17575222, 18668529, 19037992, 19275204, 22484941, 23887632, 23907458 View all (13 more)
Prostatic Neoplasms	Inhibit	25578495
Prostatic Neoplasms Castration Resistant	Associate	25027405
Prostatitis	Associate	12655519, 16309180, 18331646, 22395836, 9141489
Pterygium	Associate	21738398
Pulmonary Disease Chronic Obstructive	Associate	38162988
Purpura Thrombocytopenic Idiopathic	Associate	16368066, 17548576
Purpura Thrombocytopenic Idiopathic	Stimulate	27734765
Radicular Cyst	Associate	22207432
Rectal Fistula	Associate	37382254
Rectal Neoplasms	Associate	11875737, 16686938, 19491899
Recurrent respiratory papillomatosis	Associate	35012431
Reperfusion Injury	Stimulate	19596001, 34694031
Reproductive Tract Infections	Associate	19114327
Respiratory Tract Infections	Associate	22125429
Retinal Dysplasia	Associate	14606101
Retinoblastoma	Associate	30694025, 36284668
Rhabdomyosarcoma	Associate	17896786
Rhegmatogenous Retinal Detachment Autosomal Dominant	Associate	25991504
Ring Chromosome 20 Syndrome	Stimulate	31251836
Rufous oculocutaneous albinism	Associate	15361203
Salivary Gland Adenoma Pleomorphic	Associate	33737504
Salivary Gland Neoplasms	Associate	22313995
Severe Acute Respiratory Syndrome	Associate	19610265
Sjogren's Syndrome	Associate	12472667, 9844061
Sleep Apnea Obstructive	Stimulate	32221272
Sleep Deprivation	Associate	15138206, 26093086
Small Cell Lung Carcinoma	Associate	17091766, 20807285, 26008974, 8630278
Smooth Muscle Tumor	Associate	22457823
Splenomegaly	Stimulate	17364991
Spondylitis Ankylosing	Associate	29960293
Squamous Cell Carcinoma of Head and Neck	Associate	16254104, 22852863, 24716969, 25906090, 31894587, 35717615, 39519400, 40302074
Status Asthmaticus	Inhibit	18390829
Stomach Diseases	Associate	16270406, 20065505
Stomach Neoplasms	Associate	10027334, 11714446, 11819821, 12679905, 14716828, 15188515, 16340247, 17477770, 18240345, 22090785, 22238053, 22320960, 23564482, 23792648, 23969976 View all (15 more)
Striae Distensae	Stimulate	28784087
Tertiary Lymphoid Structures	Associate	20430737
Testicular Germ Cell Tumor	Associate	9041117
Thanatophoric Dysplasia	Stimulate	9582336
Thrombocythemia Essential	Inhibit	15271793, 22300941
Thrombocythemia Essential	Associate	22418850
Thyroid Cancer Papillary	Associate	19683979, 24081676, 31378899, 31591432, 34825595
Thyroid Carcinoma Anaplastic	Associate	21571321
Thyroid Neoplasms	Associate	18021179, 35968508
Thyroiditis	Associate	19008632
Tongue Neoplasms	Associate	28983595, 35720042
Triple Negative Breast Neoplasms	Associate	31870109, 34970732, 35056723, 37822991, 39183056
Tuberculosis	Associate	16556259
Tuberculosis Multidrug Resistant	Associate	24805866, 30126848
Turcot syndrome	Associate	10861262, 25816162
Urinary Bladder Neoplasms	Associate	26198047, 26743236, 30443191, 34790817, 34861846, 38072891
Uterine Cervical Dysplasia	Associate	15563666
Uterine Cervical Neoplasms	Associate	12562647, 15361203, 15889622, 16619552, 17324262, 19064947, 23803076, 24815470, 25142231, 29806603, 31180057, 31935210, 31983099, 32718121, 35166172 View all (5 more)
Uterine Cervical Neoplasms	Inhibit	17242701
Uterine Diseases	Associate	21804459
Uveal melanoma	Associate	24014050
Varicose Ulcer	Associate	21262580
Varicose Veins	Associate	15531194
Venous Insufficiency	Stimulate	29626597
Vitreoretinopathy Proliferative	Associate	25991504
von Hippel Lindau Disease	Associate	28094316
Waldenstrom Macroglobulinemia	Associate	25893290
Wilms Tumor	Associate	11720445

BAX (BCL2 associated X, apoptosis regulator)