Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5801
Gene name Gene Name - the full gene name approved by the HGNC.	Protein tyrosine phosphatase receptor type R
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PTPRR
Synonyms (NCBI Gene) Gene synonyms aliases	EC-PTP, PCPTP1, PTP-SL, PTPBR7, PTPRQ
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q15
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic tran

Show/Hide all(47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021209	hsa-miR-150-5p	Microarray	20218812
MIRT1276449	hsa-miR-105	CLIP-seq
MIRT1276450	hsa-miR-1275	CLIP-seq
MIRT1276451	hsa-miR-3190	CLIP-seq
MIRT1276452	hsa-miR-3681	CLIP-seq
MIRT1276453	hsa-miR-4260	CLIP-seq
MIRT1276454	hsa-miR-4491	CLIP-seq
MIRT1276455	hsa-miR-4525	CLIP-seq
MIRT1276456	hsa-miR-4657	CLIP-seq
MIRT1276457	hsa-miR-4665-5p	CLIP-seq
MIRT1276458	hsa-miR-4723-5p	CLIP-seq
MIRT1276459	hsa-miR-520d-5p	CLIP-seq
MIRT1276460	hsa-miR-524-5p	CLIP-seq
MIRT1276461	hsa-miR-625	CLIP-seq
MIRT1276449	hsa-miR-105	CLIP-seq
MIRT1276450	hsa-miR-1275	CLIP-seq
MIRT1276462	hsa-miR-3692	CLIP-seq
MIRT1276453	hsa-miR-4260	CLIP-seq
MIRT1276455	hsa-miR-4525	CLIP-seq
MIRT1276457	hsa-miR-4665-5p	CLIP-seq
MIRT1276458	hsa-miR-4723-5p	CLIP-seq
MIRT1276459	hsa-miR-520d-5p	CLIP-seq
MIRT1276460	hsa-miR-524-5p	CLIP-seq
MIRT1276461	hsa-miR-625	CLIP-seq
MIRT1276449	hsa-miR-105	CLIP-seq
MIRT2307273	hsa-miR-1237	CLIP-seq
MIRT2307274	hsa-miR-1248	CLIP-seq
MIRT1276450	hsa-miR-1275	CLIP-seq
MIRT2307275	hsa-miR-1286	CLIP-seq
MIRT2307276	hsa-miR-4255	CLIP-seq
MIRT1276453	hsa-miR-4260	CLIP-seq
MIRT2307277	hsa-miR-4448	CLIP-seq
MIRT1276455	hsa-miR-4525	CLIP-seq
MIRT2307278	hsa-miR-4663	CLIP-seq
MIRT1276457	hsa-miR-4665-5p	CLIP-seq
MIRT2307279	hsa-miR-4722-5p	CLIP-seq
MIRT1276458	hsa-miR-4723-5p	CLIP-seq
MIRT2307280	hsa-miR-4777-5p	CLIP-seq
MIRT2307281	hsa-miR-518d-5p	CLIP-seq
MIRT2307282	hsa-miR-519b-5p	CLIP-seq
MIRT2307283	hsa-miR-519c-5p	CLIP-seq
MIRT2307284	hsa-miR-520c-5p	CLIP-seq
MIRT1276459	hsa-miR-520d-5p	CLIP-seq
MIRT1276460	hsa-miR-524-5p	CLIP-seq
MIRT2307285	hsa-miR-526a	CLIP-seq
MIRT1276461	hsa-miR-625	CLIP-seq
MIRT2307286	hsa-miR-628-5p	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001701	Process	In utero embryonic development	IEP	10601328
GO:0004725	Function	Protein tyrosine phosphatase activity	TAS	7836467
GO:0005001	Function	Transmembrane receptor protein tyrosine phosphatase activity	TAS	7836467
GO:0005515	Function	Protein binding	IPI	10601328, 25241761, 28065597
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0006470	Process	Protein dephosphorylation	TAS	7836467
GO:0010633	Process	Negative regulation of epithelial cell migration	IMP	21724833
GO:0016021	Component	Integral component of membrane	IEA
GO:0019901	Function	Protein kinase binding	ISS
GO:0030054	Component	Cell junction	IDA
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IEA
GO:0038128	Process	ERBB2 signaling pathway	IMP	21724833
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IMP	21724833
GO:1903385	Process	Regulation of homophilic cell adhesion	IMP	21724833

MIM	HGNC	e!Ensembl
602853	9680	ENSG00000153233

Protein

UniProt ID

Q15256

Protein name

Receptor-type tyrosine-protein phosphatase R (R-PTP-R) (EC 3.1.3.48) (Ch-1PTPase) (NC-PTPCOM1) (Protein-tyrosine phosphatase PCPTP1)

Protein function

Sequesters mitogen-activated protein kinases (MAPKs) such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactive form. The MAPKs bind to a dephosphorylated kinase interacting motif, phosphorylation of which by the protein kinase A complex re

PDB

2A8B

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00102	Y_phosphatase	415 → 646	Protein-tyrosine phosphatase	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in cerebrospinal fluid (at protein level) (PubMed:25326458). Expressed in brain, placenta, small intestine, stomach, uterus and weakly in the prostate. Isoform alpha has been observed only in the brain. Isoform gamma is expres

Sequence

MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYKHSQDIEKSLDIAPQK
IYRHSYHSSSEAQVSKRHQIVNSAFPRPAYDPSLNLLAMDGQDLEVENLPIPAANVIVVT
LQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDAL
PSEEVLRSLNINVLHQSLSQFGITEVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVI
IVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLN
VVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIP
TPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNR
YKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVDDFWQMV
WQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTIRNLVLKQGSH
TQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIA
TSIGCQQLKEEGVVDALSIVCQLRMDRGGMVQTSEQYEFVHHALCLYESRLSAETVQ

Sequence length

657

Interactions

View interactions

	KEGG
	MAPK signaling pathway

Show/Hide Unknown Diseases (6)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Unipolar Depression, Major Depressive Disorder		22100128	ClinVar
Uterine Fibroids	Uterine Fibroids			GWAS
Diabetes	Diabetes			GWAS
Metabolic Syndrome	Metabolic Syndrome			GWAS
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.		GWAS, CBGDA
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587		GWAS, CBGDA

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	24407576
Adenocarcinoma of Lung	Associate	38280930
Carcinogenesis	Associate	20015382
Colorectal Neoplasms	Inhibit	20015382
Corticosteroid Binding Globulin Deficiency	Associate	27013170
Farber Lipogranulomatosis	Associate	24407576
Leukemia Myeloid Acute	Associate	29764005
Lung Neoplasms	Inhibit	38280930
Multiple Myeloma	Associate	34558606
Myopia	Associate	23422819
Neoplasms	Inhibit	20015382
Neoplasms	Associate	37965307, 38280930
Neurodegenerative Diseases	Associate	16441242
Pancreatic Neoplasms	Associate	28611293
Prostatic Neoplasms	Associate	25592066
Prostatic Neoplasms Castration Resistant	Associate	32133801
Status Asthmaticus	Associate	27013170

PTPRR (protein tyrosine phosphatase receptor type R)