PTPRH (protein tyrosine phosphatase receptor type H)

Gene

• Entrez ID: 5794
• Gene name: Protein tyrosine phosphatase receptor type H
• Gene symbol: PTPRH
• Synonyms (NCBI Gene): R-PTP-H, SAP1
• Chromosome: 19
• Chromosome location: 19q13.42
• Summary: The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic tran

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016746	hsa-miR-335-5p	Microarray	18185580
MIRT1276197	hsa-miR-4645-5p	CLIP-seq
MIRT1276198	hsa-miR-4673	CLIP-seq
MIRT1276199	hsa-miR-1470	CLIP-seq
MIRT1276200	hsa-miR-3074-5p	CLIP-seq
MIRT1276201	hsa-miR-3189-3p	CLIP-seq
MIRT1276202	hsa-miR-3667-3p	CLIP-seq
MIRT1276203	hsa-miR-4469	CLIP-seq
MIRT1276204	hsa-miR-4667-3p	CLIP-seq
MIRT1276205	hsa-miR-4722-3p	CLIP-seq
MIRT1276206	hsa-miR-635	CLIP-seq
MIRT1276202	hsa-miR-3667-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005001	Function	Transmembrane receptor protein tyrosine phosphatase activity	TAS	8294459
GO:0005515	Function	Protein binding	IPI	12907755, 25416956, 28065597
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8294459
GO:0005902	Component	Microvillus	IEA
GO:0006470	Process	Protein dephosphorylation	TAS	8294459
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007411	Process	Axon guidance	IBA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031528	Component	Microvillus membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045296	Function	Cadherin binding	IEA
GO:0045296	Function	Cadherin binding	IPI	28926625

Other IDs

• MIM: 602510
• HGNC: 9672
• e!Ensembl: ENSG00000080031

Protein

• UniProt ID: Q9HD43
• Protein name: Receptor-type tyrosine-protein phosphatase H (R-PTP-H) (EC 3.1.3.48) (Stomach cancer-associated protein tyrosine phosphatase 1) (SAP-1) (Transmembrane-type protein-tyrosine phosphatase type H)
• Protein function: Protein phosphatase that may contribute to contact inhibition of cell growth and motility by mediating the dephosphorylation of focal adhesion-associated substrates and thus negatively regulating integrin-promoted signaling processes. Induces ap
• PDB: 7XC0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00041	fn3	30 → 108	Fibronectin type III domain	Domain
  PF00041	fn3	119 → 195	Fibronectin type III domain	Domain
  PF00041	fn3	209 → 287	Fibronectin type III domain	Domain
  PF00041	fn3	297 → 377	Fibronectin type III domain	Domain
  PF00041	fn3	386 → 467	Fibronectin type III domain	Domain
  PF00041	fn3	566 → 656	Fibronectin type III domain	Domain
  PF00102	Y_phosphatase	844 → 1078	Protein-tyrosine phosphatase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in the brain, spleen and liver and at lower levels in the heart and stomach. Expressed in pancreatic and colorectal cancer cells, but not in normal pancreas or colon. Expression in hepatocellular carcinoma is r
• Sequence:

  MAGAGGGLGVWGNLVLLGLCSWTGARAPAPNPGRNLTVETQTTSSISLSWEVPDGLDSQN
  SNYWVQCTGDGGTTETRNTTATNVTVDGLGPGSLYTCSVWVEKDGVNSSVGTVTTATAPN
  PVRNLRVEAQTNSSIALTWEVPDGPDPQNSTYGVEYTGDGGRAGTRSTAHTNITVDGLEP
  GCLYAFSMWVGKNGINSSRETRNATTAHNPVRNLRVEAQTTSSISLSWEVPDGTDPQNST
  YCVQCTGDGGRTETRNTTDTRVTVDGLGPGSLYTCSVWVEKDGVNSSVEIVTSATAPNPV
  RNLTVEAQTNSSIALTWEVPDGPDPQNSTYGVEYTGDGGRAGTRSTAHTNITVDRLEPGC
  LYVFSVWVGKNGINSSRETRNATTAPNPVRNLHMETQTNSSIALCWEVPDGPYPQDYTYW
  VEYTGDGGGTETRNTTNTSVTAERLEPGTLYTFSVWAEKNGARGSRQNVSISTVPNAVTS
  LSKQDWTNSTIALRWTAPQGPGQSSYSYWVSWVREGMTDPRTQSTSGTDITLKELEAGSL
  YHLTVWAERNEVRGYNSTLTAATAPNEVTDLQNETQTKNSVMLWWKAPGDPHSQLYVYWV
  QWASKGHPRRGQDPQANWVNQTSRTNETWYKVEALEPGTLYNFTVWAERNDVASSTQSLC
  ASTYPDTVTITSCVSTSAGYGVNLIWSCPQGGYEAFELEVGGQRGSQDRSSCGEAVSVLG
  LGPARSYPATITTIWDGMKVVSHSVVCHTESAGVIAGAFVGILLFLILVGLLIFFLKRRN
  KKKQQKPELRDLVFSSPGDIPAEDFADHVRKNERDSNCGFADEYQQLSLVGHSQSQMVAS
  ASENNAKNRYRNVLPYDWSRVPLKPIHEEPGSDYINASFMPGLWSPQEFIATQGPLPQTV
  GDFWRLVWEQQSHTLVMLTNCMEAGRVKCEHYWPLDSQPCTHGHLRVTLVGEEVMENWTV
  RELLLLQVEEQKTLSVRQFHYQAWPDHGVPSSPDTLLAFWRMLRQWLDQTMEGGPPIVHC
  SAGVGRTGTLIALDVLLRQLQSEGLLGPFSFVRKMRESRPLMVQTEAQYVFLHQCILRFL
  QQSAQAPAEKEVPYEDVENLIYENVAAIQAHKLEV

• Sequence length: 1115

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Lung cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma of Lung	Associate	26134684, 34367321, 36793937	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	26134684	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Stimulate	26134684	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	36054194	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	8294459	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Associate	8294459	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	26134684, 36054194	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	36793937	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	32132299, 36054194	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	35246212	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Associate	35246212	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	24848881	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	8294459	★☆☆☆☆ Found in Text Mining only