Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5789
Gene name	Protein tyrosine phosphatase receptor type D
Gene symbol	PTPRD
Synonyms (NCBI Gene)	HPTPHPTPDHPTPDELTAPTPDR-PTP-deltaRPTPDELTA
Chromosome	9
Chromosome location	9p24.1-p23
Summary	The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic tran

Show/Hide all (75)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016634	hsa-miR-429	Reporter assay	20005803
MIRT020345	hsa-miR-200a-3p	Reporter assay	20005803
MIRT021067	hsa-miR-200c-3p	Reporter assay	20005803
MIRT021661	hsa-miR-141-3p	Reporter assay	20005803
MIRT023978	hsa-miR-1-3p	Microarray	18668037
MIRT024123	hsa-miR-200b-3p	Reporter assay	20005803
MIRT555148	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT555147	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT555146	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT555145	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT555144	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT555142	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT555143	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT555141	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT555140	hsa-miR-5583-3p	PAR-CLIP	21572407
MIRT555139	hsa-miR-646	PAR-CLIP	21572407
MIRT555138	hsa-miR-3163	PAR-CLIP	21572407
MIRT325265	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT555137	hsa-miR-8076	PAR-CLIP	21572407
MIRT555136	hsa-miR-1246	PAR-CLIP	21572407
MIRT555135	hsa-miR-891b	PAR-CLIP	21572407
MIRT555134	hsa-miR-3201	PAR-CLIP	21572407
MIRT555132	hsa-miR-4791	PAR-CLIP	21572407
MIRT555133	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT555131	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT555130	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT325259	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT555129	hsa-miR-3924	PAR-CLIP	21572407
MIRT555128	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT555148	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT555147	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT555146	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT555145	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT555144	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT555142	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT555143	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT555141	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT555140	hsa-miR-5583-3p	PAR-CLIP	21572407
MIRT555139	hsa-miR-646	PAR-CLIP	21572407
MIRT555138	hsa-miR-3163	PAR-CLIP	21572407
MIRT325265	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT555137	hsa-miR-8076	PAR-CLIP	21572407
MIRT555136	hsa-miR-1246	PAR-CLIP	21572407
MIRT555135	hsa-miR-891b	PAR-CLIP	21572407
MIRT555134	hsa-miR-3201	PAR-CLIP	21572407
MIRT555132	hsa-miR-4791	PAR-CLIP	21572407
MIRT555133	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT555131	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT555130	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT325259	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT555129	hsa-miR-3924	PAR-CLIP	21572407
MIRT555128	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT1276000	hsa-miR-1261	CLIP-seq
MIRT1276001	hsa-miR-135a	CLIP-seq
MIRT1276002	hsa-miR-135b	CLIP-seq
MIRT1276003	hsa-miR-186	CLIP-seq
MIRT1276004	hsa-miR-204	CLIP-seq
MIRT1276005	hsa-miR-211	CLIP-seq
MIRT1276006	hsa-miR-3126-3p	CLIP-seq
MIRT1276007	hsa-miR-3128	CLIP-seq
MIRT1276008	hsa-miR-3133	CLIP-seq
MIRT1276009	hsa-miR-3614-5p	CLIP-seq
MIRT1276010	hsa-miR-4446-5p	CLIP-seq
MIRT1276011	hsa-miR-4633-5p	CLIP-seq
MIRT1276012	hsa-miR-4720-5p	CLIP-seq
MIRT1276013	hsa-miR-4755-5p	CLIP-seq
MIRT1276014	hsa-miR-4799-3p	CLIP-seq
MIRT1276015	hsa-miR-515-5p	CLIP-seq
MIRT1276016	hsa-miR-623	CLIP-seq
MIRT1276017	hsa-miR-890	CLIP-seq
MIRT1276018	hsa-miR-4536	CLIP-seq
MIRT1276019	hsa-miR-4666-5p	CLIP-seq
MIRT1276020	hsa-miR-642a	CLIP-seq
MIRT2081184	hsa-miR-3646	CLIP-seq
MIRT2081185	hsa-miR-3978	CLIP-seq

Show/Hide all (52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005001	Function	Transmembrane receptor protein tyrosine phosphatase activity	IEA
GO:0005001	Function	Transmembrane receptor protein tyrosine phosphatase activity	TAS	7896816
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	ISS
GO:0005515	Function	Protein binding	IPI	12570871, 22305495
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7896816
GO:0006796	Process	Phosphate-containing compound metabolic process	NAS	7896816
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007185	Process	Cell surface receptor protein tyrosine phosphatase signaling pathway	IEA
GO:0007185	Process	Cell surface receptor protein tyrosine phosphatase signaling pathway	TAS	7896816
GO:0007399	Process	Nervous system development	IBA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030182	Process	Neuron differentiation	ISS
GO:0042734	Component	Presynaptic membrane	IEA
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IEA
GO:0050775	Process	Positive regulation of dendrite morphogenesis	IEA
GO:0050776	Process	Regulation of immune response	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050839	Function	Cell adhesion molecule binding	IEA
GO:0050839	Function	Cell adhesion molecule binding	ISS
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0051965	Process	Positive regulation of synapse assembly	ISS
GO:0061003	Process	Positive regulation of dendritic spine morphogenesis	IEA
GO:0061003	Process	Positive regulation of dendritic spine morphogenesis	ISS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0097105	Process	Presynaptic membrane assembly	IEA
GO:0097105	Process	Presynaptic membrane assembly	ISS
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IDA	21926414
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IMP	21926414
GO:0099054	Process	Presynapse assembly	IDA	21926414
GO:0099054	Process	Presynapse assembly	IEA
GO:0099054	Process	Presynapse assembly	IMP	21926414
GO:0099151	Process	Regulation of postsynaptic density assembly	IEA
GO:0099537	Process	Trans-synaptic signaling	IEA
GO:0099545	Process	Trans-synaptic signaling by trans-synaptic complex	IDA	21926414
GO:0099545	Process	Trans-synaptic signaling by trans-synaptic complex	IMP	21926414
GO:0099560	Process	Synaptic membrane adhesion	IBA
GO:0099560	Process	Synaptic membrane adhesion	IDA	23345436
GO:0099560	Process	Synaptic membrane adhesion	IEA
GO:0099560	Process	Synaptic membrane adhesion	IMP	23345436
GO:0099560	Process	Synaptic membrane adhesion	ISS

MIM	HGNC	e!Ensembl
601598	9668	ENSG00000153707

P23468

Protein name

Receptor-type tyrosine-protein phosphatase delta (Protein-tyrosine phosphatase delta) (R-PTP-delta) (EC 3.1.3.48)

Protein function

Can bidirectionally induce pre- and post-synaptic differentiation of neurons by mediating interaction with IL1RAP and IL1RAPL1 trans-synaptically. Involved in pre-synaptic differentiation through interaction with SLITRK2. {ECO:0000250|UniProtKB:

PDB

1X5Z , 2DLH , 2YD6 , 2YD7 , 4RCA , 5WY8 , 5XNP , 6X3A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07679	I-set	24 → 115	Immunoglobulin I-set domain	Domain
PF07679	I-set	126 → 225	Immunoglobulin I-set domain	Domain
PF13927	Ig_3	235 → 306		Domain
PF00041	fn3	324 → 405	Fibronectin type III domain	Domain
PF00041	fn3	419 → 504	Fibronectin type III domain	Domain
PF00041	fn3	517 → 597	Fibronectin type III domain	Domain
PF00041	fn3	611 → 699	Fibronectin type III domain	Domain
PF00041	fn3	713 → 812	Fibronectin type III domain	Domain
PF00041	fn3	825 → 907	Fibronectin type III domain	Domain
PF00041	fn3	920 → 1006	Fibronectin type III domain	Domain
PF00102	Y_phosphatase	1380 → 1611	Protein-tyrosine phosphatase	Domain
PF00102	Y_phosphatase	1669 → 1902	Protein-tyrosine phosphatase	Domain

Sequence

MVHVARLLLLLLTFFLRTDAETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKK
GKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLREDQ
IPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRS
ESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRELREVRRVPPRFSI
PPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNVLELNDVRQSANY
TCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSGNPEPVSYYIIQHKP
KNSEELYKEIDGVATTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSA
PRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIG
NLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPR
SDTIANYELVYKDGEHGEEQRITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEI
SARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSIKYTAVDGEDDKPH
EILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSVLIRTNEDVPSGPPRKVEV
EAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEFDDT
TEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTGAVPGKPRLVINHTQMNTAL
IQWHPPVDTFGPLQGYRLKFGRKDMEPLTTLEFSEKEDHFTATDIHKGASYVFRLSARNK
VGFGEEMVKEISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRD
INIPLLPMEQLIVPADTTMTLTGLKPDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQVF
AKNFHVKAVMKTSVLLSWEIPENYNSAMPFKILYDDGKMVEEVDGRATQKLIVNLKPEKS
YSFVLTNRGNSAGGLQHRVTAKTAPDVLRTKPAFIGKTNLDGMITVQLPEVPANENIKGY
YIIIVPLKKSRGKFIKPWESPDEMELDELLKEISRKRRSIRYGREVELKPYIAAHFDVLP
TEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPI
TDEEEGLIWVVGPVLAVVFIICIVIAILLYKRKRAESDSRKSSIPNNKEIPSHHPTDPVE
LRRLNFQTPGMASHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVN
KPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFW
RMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFAL
YKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRT
GCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEV
PARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMP
YESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIV
VMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTV
RQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIV
LERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYLGSFDHYAT

Sequence length

1912

Interactions

View interactions

	KEGG		Reactome
	Cell adhesion molecules		Receptor-type tyrosine-protein phosphatases Synaptic adhesion-like molecules

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Clear cell carcinoma of kidney	Benign	rs143674254	RCV005905238
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	rs2074236485	RCV004557907
Gastric cancer	Likely benign	rs147417729	RCV005933467
Prostate cancer	Uncertain significance	rs150063446	RCV000149336
PTPRD-related disorder	Benign; Uncertain significance; Likely benign	rs10977171, rs368787989, rs183119115, rs142228841, rs61733168, rs145325302, rs146973770, rs12346849, rs201761674, rs138805005, rs2281747, rs3763653, rs373588955, rs2551854134, rs150856940 View all (38 more)	RCV003968416 RCV003419036 RCV003919225 RCV003939034 RCV003919226 RCV003946615 RCV003921499 RCV003919606 RCV003981678 RCV003981772 RCV003984792 RCV003982511 RCV003977110 RCV003982324 RCV003911544 RCV003933954 RCV003941882 RCV003942111 RCV003944169 RCV003959718 RCV003919524 RCV003931453 RCV003931573 RCV003951603 RCV003961446 RCV003951548 RCV003971362 RCV003936815 RCV003942166 RCV003949108 RCV003944674 RCV003982105 RCV003947288 RCV003962050 RCV003976479 RCV003925905 RCV003916129 RCV003972851 RCV003935986 RCV003928458 RCV003916138 RCV003905964 RCV003920738 RCV003930780 RCV003940430 RCV003968377 RCV003920854 RCV003950698 RCV003912874 RCV003902854 RCV003920849 RCV003960717 RCV003918634
Sarcoma	Benign	rs143674254	RCV005905239
Thyroid cancer, nonmedullary, 1	Benign	rs143674254	RCV005905240

Show/Hide Text Mining Associations (68)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	18948947, 33979320
Alzheimer Disease	Associate	35627222, 36553611
Astrocytoma	Associate	35982066
Attention Deficit Disorder with Hyperactivity	Associate	19546859
Breast Neoplasms	Associate	25570853
Calcinosis Cutis	Associate	23800680
Carcinogenesis	Associate	25412184
Carcinoma Hepatocellular	Associate	22326833, 28159835
Carcinoma Large Cell	Associate	35641209
Carcinoma Non Small Cell Lung	Associate	34615542, 35603359, 35798829, 37602864
Carcinoma Renal Cell	Associate	21387281
Carcinoma Squamous Cell	Associate	17420988, 28099906
Carcinoma Squamous Cell	Inhibit	19131950
Colonic Neoplasms	Associate	25113440
Colorectal Neoplasms	Associate	23975090
Coronary Artery Disease	Associate	22216278
COVID 19	Associate	39457114
Death	Associate	26755275
Desmoplastic Small Round Cell Tumor	Associate	25119929
Developmental Disabilities	Associate	31088393
Diabetes Gestational	Associate	27738328
Diabetes Mellitus	Associate	20174558, 23147557
Diabetes Mellitus Type 2	Associate	23147557, 26168825, 26292654, 27738328, 33706321
Endometriosis	Associate	33436679
Epilepsy	Associate	23962720
Gastroschisis	Associate	31075877
Glioblastoma	Inhibit	19478061
Glioblastoma	Associate	25113440, 33470396
Glioma	Associate	19478061
Head and Neck Neoplasms	Associate	26267899
Hyperphagia	Associate	36812308
Hypertension	Associate	26425837
Intellectual Disability	Associate	31088393
Laryngeal Neoplasms	Associate	34299935
Leukemia B Cell	Associate	27335277
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	23651669
Lewy Body Disease	Associate	28322283
Liver Diseases	Associate	28159835
Lung Neoplasms	Associate	17420988, 19478061
Lung Neoplasms	Inhibit	20073072
Lymphoma	Associate	27335277
Lymphoma B Cell Marginal Zone	Associate	27335277
Melanoma	Associate	25113440, 25393105, 35603359, 35798829
Mental Disorders	Associate	39457114
Mood Disorders	Associate	29187730
Neoplasm Metastasis	Associate	17420988
Neoplasm Metastasis	Inhibit	31805999
Neoplasms	Inhibit	17420988, 19131950, 19478061, 20073072, 22121227, 22305495, 25412184, 26267899, 28159835, 28345455, 31805999
Neoplasms	Associate	18948947, 23289484, 25113440, 25393105, 27501229, 31576098, 32151175, 34299935, 35603359, 35982066, 36248841, 37602864, 40698865
Neuroblastoma	Associate	17420988, 22305495, 22367537, 23991058
Neurodegenerative Diseases	Associate	22121227
Nocturnal Myoclonus Syndrome	Associate	25142570
Obesity	Associate	36812308
Obsessive Compulsive Disorder	Associate	24821223
Oligodendroglioma	Associate	35982066
Pancreatic Cyst	Associate	31576098
Pancreatic Neoplasms	Associate	26755275, 28099906
Precancerous Conditions	Associate	31576098
Restless Legs Syndrome	Associate	19546859, 21264940, 21572129, 24293752, 25817513
Sarcoma Ewing	Associate	23800680, 25119929
Seizures	Associate	23962720
Small Cell Lung Carcinoma	Associate	35641209
Squamous Cell Carcinoma of Head and Neck	Associate	26267899, 27501229, 28345455
Stomach Neoplasms	Associate	20331625, 25412184, 28426752
Stomach Neoplasms	Inhibit	31805999
Thyroid Cancer Papillary	Associate	32151175
Urinary Bladder Neoplasms	Associate	33221763
Vascular Diseases	Associate	19525478

PTPRD (protein tyrosine phosphatase receptor type D)