ZP4 (zona pellucida glycoprotein 4)

Gene

• Entrez ID: 57829
• Gene name: Zona pellucida glycoprotein 4
• Gene symbol: ZP4
• Synonyms (NCBI Gene): ZBP, ZP1, ZP1B, ZPB, ZPB2, Zp-4
• Chromosome: 1
• Chromosome location: 1q43
• Summary: The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The nascent protein contains a N

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1543360	hsa-miR-1207-5p	CLIP-seq
MIRT1543361	hsa-miR-1292	CLIP-seq
MIRT1543362	hsa-miR-1303	CLIP-seq
MIRT1543363	hsa-miR-1324	CLIP-seq
MIRT1543364	hsa-miR-30a	CLIP-seq
MIRT1543365	hsa-miR-30b	CLIP-seq
MIRT1543366	hsa-miR-30c	CLIP-seq
MIRT1543367	hsa-miR-30d	CLIP-seq
MIRT1543368	hsa-miR-30e	CLIP-seq
MIRT1543369	hsa-miR-4495	CLIP-seq
MIRT1543370	hsa-miR-4736	CLIP-seq
MIRT1543371	hsa-miR-4763-3p	CLIP-seq
MIRT1543372	hsa-miR-591	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002922	Process	Positive regulation of humoral immune response	IDA	19004505
GO:0005515	Function	Protein binding	IPI	15950651, 23355646
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0007339	Process	Binding of sperm to zona pellucida	IBA
GO:0016020	Component	Membrane	IEA
GO:0031012	Component	Extracellular matrix	IBA
GO:0032190	Function	Acrosin binding	IBA
GO:0032190	Function	Acrosin binding	IPI	15950651
GO:0035804	Function	Structural constituent of egg coat	IBA
GO:0035804	Function	Structural constituent of egg coat	ISS
GO:0035805	Component	Egg coat	IBA
GO:0035805	Component	Egg coat	IDA	29895852
GO:0035805	Component	Egg coat	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	19004505
GO:0042802	Function	Identical protein binding	IPI	26879157
GO:0060468	Process	Prevention of polyspermy	IBA
GO:0060478	Process	Acrosomal vesicle exocytosis	IMP	19004505
GO:2000344	Process	Positive regulation of acrosome reaction	IDA	18667750, 20394732
GO:2000360	Process	Negative regulation of binding of sperm to zona pellucida	IDA	18667750

Other IDs

• MIM: 613514
• HGNC: 15770
• e!Ensembl: ENSG00000116996

Protein

• UniProt ID: Q12836
• Protein name: Zona pellucida sperm-binding protein 4 (Zona pellucida glycoprotein 4) (Zp-4) (Zona pellucida protein B) [Cleaved into: Processed zona pellucida sperm-binding protein 4]
• Protein function: Component of the zona pellucida, an extracellular matrix surrounding oocytes which mediates sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy. The zona pellucida is composed of 3 to 4 glycoproteins, ZP1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00088	Trefoil	143 → 182	Trefoil (P-type) domain	Domain
  PF00100	Zona_pellucida	189 → 460	Zona pellucida-like domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in oocytes.
• Sequence:

  MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEATSPPVLIAWDN
  QGLLHELQNDSDCGTWIRKGPGSSVVLEATYSSCYVTEWDSHYIMPVGVEGAGAAEHKVV
  TERKLLKCPMDLLARDAPDTDWCDSIPARDRLPCAPSPISRGDCEGLGCCYSSEEVNSCY
  YGNTVTLHCTREGHFSIAVSRNVTSPPLLLDSVRLALRNDSACNPVMATQAFVLFQFPFT
  SCGTTRQITGDRAVYENELVATRDVKNGSRGSVTRDSIFRLHVSCSYSVSSNSLPINVQV
  FTLPPPFPETQPGPLTLELQIAKDKNYGSYYGVGDYPVVKLLRDPIYVEVSILHRTDPYL
  GLLLQQCWATPSTDPLSQPQWPILVKGCPYIGDNYQTQLIPVQKALDLPFPSHHQRFSIF
  TFSFVNPTVEKQALRGPVHLHCSVSVCQPAETPSCVVTCPDLSRRRNFDNSSQNTTASVS
  SKGPMILLQATKDPPEKLRVPVDSKVLWVAGLSGTLILGALLVSYLAVKKQKSCPDQMCQ
  

• Sequence length: 540

Pathways

Reactome:

Interaction With Cumulus Cells And The Zona Pellucida

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS OF LIVER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Infertility	Associate	25740067	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	31314571	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Associate	25740067	★☆☆☆☆ Found in Text Mining only