Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	57761
Gene name	Tribbles pseudokinase 3
Gene symbol	TRIB3
Synonyms (NCBI Gene)	C20orf97NIPKSINKSKIP3TRB3
Chromosome	20
Chromosome location	20p13
Summary	The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, th

309

Show/Hide all (309)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003354	hsa-miR-24-3p	qRT-PCRWestern blot	20019669
MIRT019155	hsa-miR-335-5p	Microarray	18185580
MIRT023198	hsa-miR-124-3p	Microarray	18668037
MIRT024900	hsa-miR-215-5p	Microarray	19074876
MIRT026958	hsa-miR-192-5p	Microarray	19074876
MIRT030272	hsa-miR-26b-5p	Microarray	19088304
MIRT003354	hsa-miR-24-3p	Microarray	19748357
MIRT049873	hsa-miR-31-5p	CLASH	23622248
MIRT438742	hsa-miR-219a-5p	qRT-PCR	24974767
MIRT438742	hsa-miR-219a-5p	qRT-PCR	24974767
MIRT438129	hsa-miR-96-5p	ImmunoblotLuciferase reporter assayqRT-PCR	24375867
MIRT438129	hsa-miR-96-5p	ImmunoblotLuciferase reporter assayqRT-PCR	24375867
MIRT438742	hsa-miR-219a-5p	qRT-PCR	24974767
MIRT438742	hsa-miR-219a-5p	qRT-PCR	24974767
MIRT438129	hsa-miR-96-5p	ImmunoblotLuciferase reporter assayqRT-PCR	24375867
MIRT438129	hsa-miR-96-5p	ImmunoblotLuciferase reporter assayqRT-PCR	24375867
MIRT023198	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT465294	hsa-miR-4464	PAR-CLIP	20371350
MIRT465293	hsa-miR-4748	PAR-CLIP	20371350
MIRT561426	hsa-miR-1237-3p	PAR-CLIP	20371350
MIRT561425	hsa-miR-875-3p	PAR-CLIP	20371350
MIRT561424	hsa-miR-6128	PAR-CLIP	20371350
MIRT370117	hsa-miR-605-3p	PAR-CLIP	20371350
MIRT465287	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT561423	hsa-miR-4533	PAR-CLIP	20371350
MIRT561422	hsa-miR-3202	PAR-CLIP	20371350
MIRT465286	hsa-miR-4284	PAR-CLIP	20371350
MIRT003354	hsa-miR-24-3p	PAR-CLIP	20371350
MIRT561421	hsa-miR-1299	PAR-CLIP	20371350
MIRT561420	hsa-miR-516b-5p	PAR-CLIP	20371350
MIRT561419	hsa-miR-4782-5p	PAR-CLIP	20371350
MIRT561418	hsa-miR-5706	PAR-CLIP	20371350
MIRT465285	hsa-miR-8057	PAR-CLIP	20371350
MIRT023198	hsa-miR-124-3p	PAR-CLIP	23592263
MIRT370131	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT370133	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT370119	hsa-miR-940	PAR-CLIP	23592263
MIRT465294	hsa-miR-4464	PAR-CLIP	23592263
MIRT465293	hsa-miR-4748	PAR-CLIP	23592263
MIRT465292	hsa-miR-5000-5p	PAR-CLIP	23592263
MIRT465291	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT465290	hsa-miR-4257	PAR-CLIP	23592263
MIRT370126	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT465289	hsa-miR-584-3p	PAR-CLIP	23592263
MIRT465288	hsa-miR-4277	PAR-CLIP	23592263
MIRT465287	hsa-miR-493-3p	PAR-CLIP	23592263
MIRT370129	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT370120	hsa-miR-1827	PAR-CLIP	23592263
MIRT370125	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT370121	hsa-miR-4434	PAR-CLIP	23592263
MIRT370123	hsa-miR-4516	PAR-CLIP	23592263
MIRT370127	hsa-miR-5703	PAR-CLIP	23592263
MIRT465286	hsa-miR-4284	PAR-CLIP	23592263
MIRT003354	hsa-miR-24-3p	PAR-CLIP	23592263
MIRT465285	hsa-miR-8057	PAR-CLIP	23592263
MIRT023198	hsa-miR-124-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	27845424
MIRT023198	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT465294	hsa-miR-4464	PAR-CLIP	20371350
MIRT465293	hsa-miR-4748	PAR-CLIP	20371350
MIRT561426	hsa-miR-1237-3p	PAR-CLIP	20371350
MIRT561425	hsa-miR-875-3p	PAR-CLIP	20371350
MIRT561424	hsa-miR-6128	PAR-CLIP	20371350
MIRT370117	hsa-miR-605-3p	PAR-CLIP	20371350
MIRT465287	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT561423	hsa-miR-4533	PAR-CLIP	20371350
MIRT561422	hsa-miR-3202	PAR-CLIP	20371350
MIRT465286	hsa-miR-4284	PAR-CLIP	20371350
MIRT003354	hsa-miR-24-3p	PAR-CLIP	20371350
MIRT561421	hsa-miR-1299	PAR-CLIP	20371350
MIRT561420	hsa-miR-516b-5p	PAR-CLIP	20371350
MIRT561419	hsa-miR-4782-5p	PAR-CLIP	20371350
MIRT561418	hsa-miR-5706	PAR-CLIP	20371350
MIRT465285	hsa-miR-8057	PAR-CLIP	20371350
MIRT023198	hsa-miR-124-3p	PAR-CLIP	23592263
MIRT370131	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT370133	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT370119	hsa-miR-940	PAR-CLIP	23592263
MIRT465294	hsa-miR-4464	PAR-CLIP	23592263
MIRT465293	hsa-miR-4748	PAR-CLIP	23592263
MIRT465292	hsa-miR-5000-5p	PAR-CLIP	23592263
MIRT465291	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT465290	hsa-miR-4257	PAR-CLIP	23592263
MIRT370126	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT465289	hsa-miR-584-3p	PAR-CLIP	23592263
MIRT465288	hsa-miR-4277	PAR-CLIP	23592263
MIRT465287	hsa-miR-493-3p	PAR-CLIP	23592263
MIRT370129	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT370120	hsa-miR-1827	PAR-CLIP	23592263
MIRT370125	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT370121	hsa-miR-4434	PAR-CLIP	23592263
MIRT370123	hsa-miR-4516	PAR-CLIP	23592263
MIRT370127	hsa-miR-5703	PAR-CLIP	23592263
MIRT465286	hsa-miR-4284	PAR-CLIP	23592263
MIRT003354	hsa-miR-24-3p	PAR-CLIP	23592263
MIRT465285	hsa-miR-8057	PAR-CLIP	23592263
MIRT1452813	hsa-miR-1237	CLIP-seq
MIRT1452814	hsa-miR-124	CLIP-seq
MIRT1452815	hsa-miR-1245b-5p	CLIP-seq
MIRT1452816	hsa-miR-1254	CLIP-seq
MIRT1452817	hsa-miR-1271	CLIP-seq
MIRT1452818	hsa-miR-1295	CLIP-seq
MIRT1452819	hsa-miR-132	CLIP-seq
MIRT1452820	hsa-miR-182	CLIP-seq
MIRT1452821	hsa-miR-204	CLIP-seq
MIRT1452822	hsa-miR-211	CLIP-seq
MIRT1452823	hsa-miR-212	CLIP-seq
MIRT1452824	hsa-miR-216b	CLIP-seq
MIRT1452825	hsa-miR-30a	CLIP-seq
MIRT1452826	hsa-miR-30b	CLIP-seq
MIRT1452827	hsa-miR-30c	CLIP-seq
MIRT1452828	hsa-miR-30d	CLIP-seq
MIRT1452829	hsa-miR-30e	CLIP-seq
MIRT1452830	hsa-miR-3116	CLIP-seq
MIRT1452831	hsa-miR-3142	CLIP-seq
MIRT1452832	hsa-miR-3180-5p	CLIP-seq
MIRT1452833	hsa-miR-3189-5p	CLIP-seq
MIRT1452834	hsa-miR-3612	CLIP-seq
MIRT1452835	hsa-miR-3622a-5p	CLIP-seq
MIRT1452836	hsa-miR-3907	CLIP-seq
MIRT1452837	hsa-miR-3921	CLIP-seq
MIRT1452838	hsa-miR-4287	CLIP-seq
MIRT1452839	hsa-miR-4323	CLIP-seq
MIRT1452840	hsa-miR-4423-3p	CLIP-seq
MIRT1452841	hsa-miR-4424	CLIP-seq
MIRT1452842	hsa-miR-4428	CLIP-seq
MIRT1452843	hsa-miR-4443	CLIP-seq
MIRT1452844	hsa-miR-4469	CLIP-seq
MIRT1452845	hsa-miR-4653-5p	CLIP-seq
MIRT1452846	hsa-miR-4685-3p	CLIP-seq
MIRT1452847	hsa-miR-4711-5p	CLIP-seq
MIRT1452848	hsa-miR-4768-5p	CLIP-seq
MIRT1452849	hsa-miR-4773	CLIP-seq
MIRT1452850	hsa-miR-493	CLIP-seq
MIRT1452851	hsa-miR-506	CLIP-seq
MIRT1452852	hsa-miR-516b	CLIP-seq
MIRT1452853	hsa-miR-520a-5p	CLIP-seq
MIRT1452854	hsa-miR-525-5p	CLIP-seq
MIRT1452855	hsa-miR-526b	CLIP-seq
MIRT1452856	hsa-miR-650	CLIP-seq
MIRT1452857	hsa-miR-875-5p	CLIP-seq
MIRT1452858	hsa-miR-96	CLIP-seq
MIRT2135614	hsa-miR-1178	CLIP-seq
MIRT1452815	hsa-miR-1245b-5p	CLIP-seq
MIRT1452816	hsa-miR-1254	CLIP-seq
MIRT1452817	hsa-miR-1271	CLIP-seq
MIRT1452818	hsa-miR-1295	CLIP-seq
MIRT2135615	hsa-miR-147	CLIP-seq
MIRT1452824	hsa-miR-216b	CLIP-seq
MIRT2135616	hsa-miR-217	CLIP-seq
MIRT2135617	hsa-miR-219-1-3p	CLIP-seq
MIRT2135618	hsa-miR-3065-3p	CLIP-seq
MIRT1452825	hsa-miR-30a	CLIP-seq
MIRT1452826	hsa-miR-30b	CLIP-seq
MIRT1452827	hsa-miR-30c	CLIP-seq
MIRT1452828	hsa-miR-30d	CLIP-seq
MIRT1452829	hsa-miR-30e	CLIP-seq
MIRT1452830	hsa-miR-3116	CLIP-seq
MIRT2135619	hsa-miR-3121-5p	CLIP-seq
MIRT1452831	hsa-miR-3142	CLIP-seq
MIRT2135620	hsa-miR-3190	CLIP-seq
MIRT2135621	hsa-miR-330-3p	CLIP-seq
MIRT1452835	hsa-miR-3622a-5p	CLIP-seq
MIRT2135622	hsa-miR-3911	CLIP-seq
MIRT2135623	hsa-miR-4279	CLIP-seq
MIRT2135624	hsa-miR-4421	CLIP-seq
MIRT1452840	hsa-miR-4423-3p	CLIP-seq
MIRT1452842	hsa-miR-4428	CLIP-seq
MIRT2135625	hsa-miR-4468	CLIP-seq
MIRT2135626	hsa-miR-4677-3p	CLIP-seq
MIRT2135627	hsa-miR-4679	CLIP-seq
MIRT2135628	hsa-miR-4682	CLIP-seq
MIRT2135629	hsa-miR-4718	CLIP-seq
MIRT2135630	hsa-miR-4725-5p	CLIP-seq
MIRT2135631	hsa-miR-500a	CLIP-seq
MIRT2135632	hsa-miR-504	CLIP-seq
MIRT2135633	hsa-miR-571	CLIP-seq
MIRT2135634	hsa-miR-576-3p	CLIP-seq
MIRT2135635	hsa-miR-644	CLIP-seq
MIRT2135636	hsa-miR-873	CLIP-seq
MIRT1452858	hsa-miR-96	CLIP-seq
MIRT2135614	hsa-miR-1178	CLIP-seq
MIRT1452813	hsa-miR-1237	CLIP-seq
MIRT1452814	hsa-miR-124	CLIP-seq
MIRT1452816	hsa-miR-1254	CLIP-seq
MIRT1452817	hsa-miR-1271	CLIP-seq
MIRT1452819	hsa-miR-132	CLIP-seq
MIRT1452823	hsa-miR-212	CLIP-seq
MIRT2356752	hsa-miR-2355-5p	CLIP-seq
MIRT2356753	hsa-miR-24	CLIP-seq
MIRT2135618	hsa-miR-3065-3p	CLIP-seq
MIRT1452825	hsa-miR-30a	CLIP-seq
MIRT1452826	hsa-miR-30b	CLIP-seq
MIRT1452827	hsa-miR-30c	CLIP-seq
MIRT1452828	hsa-miR-30d	CLIP-seq
MIRT1452829	hsa-miR-30e	CLIP-seq
MIRT1452830	hsa-miR-3116	CLIP-seq
MIRT2135619	hsa-miR-3121-5p	CLIP-seq
MIRT2356754	hsa-miR-3158-3p	CLIP-seq
MIRT2356755	hsa-miR-3161	CLIP-seq
MIRT2356756	hsa-miR-3177-5p	CLIP-seq
MIRT2356757	hsa-miR-3622a-3p	CLIP-seq
MIRT1452835	hsa-miR-3622a-5p	CLIP-seq
MIRT2356758	hsa-miR-3622b-3p	CLIP-seq
MIRT2356759	hsa-miR-3657	CLIP-seq
MIRT2356760	hsa-miR-3690	CLIP-seq
MIRT1452838	hsa-miR-4287	CLIP-seq
MIRT1452840	hsa-miR-4423-3p	CLIP-seq
MIRT1452841	hsa-miR-4424	CLIP-seq
MIRT2135625	hsa-miR-4468	CLIP-seq
MIRT1452844	hsa-miR-4469	CLIP-seq
MIRT2356761	hsa-miR-4511	CLIP-seq
MIRT2356762	hsa-miR-4523	CLIP-seq
MIRT2356763	hsa-miR-4650-5p	CLIP-seq
MIRT2356764	hsa-miR-4672	CLIP-seq
MIRT2135626	hsa-miR-4677-3p	CLIP-seq
MIRT2135627	hsa-miR-4679	CLIP-seq
MIRT1452846	hsa-miR-4685-3p	CLIP-seq
MIRT2356765	hsa-miR-4713-5p	CLIP-seq
MIRT2356766	hsa-miR-4727-5p	CLIP-seq
MIRT1452849	hsa-miR-4773	CLIP-seq
MIRT1452850	hsa-miR-493	CLIP-seq
MIRT1452851	hsa-miR-506	CLIP-seq
MIRT1452852	hsa-miR-516b	CLIP-seq
MIRT1452855	hsa-miR-526b	CLIP-seq
MIRT2135634	hsa-miR-576-3p	CLIP-seq
MIRT2356767	hsa-miR-711	CLIP-seq
MIRT1452858	hsa-miR-96	CLIP-seq
MIRT2396340	hsa-miR-3136-3p	CLIP-seq
MIRT2396341	hsa-miR-605	CLIP-seq
MIRT1452814	hsa-miR-124	CLIP-seq
MIRT2356753	hsa-miR-24	CLIP-seq
MIRT1452850	hsa-miR-493	CLIP-seq
MIRT1452851	hsa-miR-506	CLIP-seq
MIRT2462315	hsa-miR-1912	CLIP-seq
MIRT2462316	hsa-miR-199a-5p	CLIP-seq
MIRT2462317	hsa-miR-199b-5p	CLIP-seq
MIRT2462318	hsa-miR-3130-5p	CLIP-seq
MIRT2462319	hsa-miR-4280	CLIP-seq
MIRT2462320	hsa-miR-4482	CLIP-seq
MIRT2462321	hsa-miR-520d-5p	CLIP-seq
MIRT2462322	hsa-miR-520g	CLIP-seq
MIRT2462323	hsa-miR-520h	CLIP-seq
MIRT2462324	hsa-miR-524-5p	CLIP-seq
MIRT1452816	hsa-miR-1254	CLIP-seq
MIRT1452821	hsa-miR-204	CLIP-seq
MIRT1452822	hsa-miR-211	CLIP-seq
MIRT1452830	hsa-miR-3116	CLIP-seq
MIRT1452832	hsa-miR-3180-5p	CLIP-seq
MIRT1452833	hsa-miR-3189-5p	CLIP-seq
MIRT2356760	hsa-miR-3690	CLIP-seq
MIRT1452836	hsa-miR-3907	CLIP-seq
MIRT1452837	hsa-miR-3921	CLIP-seq
MIRT1452838	hsa-miR-4287	CLIP-seq
MIRT1452839	hsa-miR-4323	CLIP-seq
MIRT2135624	hsa-miR-4421	CLIP-seq
MIRT2356763	hsa-miR-4650-5p	CLIP-seq
MIRT1452845	hsa-miR-4653-5p	CLIP-seq
MIRT1452846	hsa-miR-4685-3p	CLIP-seq
MIRT2650245	hsa-miR-4714-3p	CLIP-seq
MIRT2135630	hsa-miR-4725-5p	CLIP-seq
MIRT2650246	hsa-miR-4766-5p	CLIP-seq
MIRT1452848	hsa-miR-4768-5p	CLIP-seq
MIRT1452849	hsa-miR-4773	CLIP-seq
MIRT2135631	hsa-miR-500a	CLIP-seq
MIRT2135632	hsa-miR-504	CLIP-seq
MIRT1452853	hsa-miR-520a-5p	CLIP-seq
MIRT1452854	hsa-miR-525-5p	CLIP-seq
MIRT2650247	hsa-miR-563	CLIP-seq
MIRT2356767	hsa-miR-711	CLIP-seq
MIRT1452857	hsa-miR-875-5p	CLIP-seq
MIRT2694109	hsa-miR-1207-3p	CLIP-seq
MIRT1452816	hsa-miR-1254	CLIP-seq
MIRT1452819	hsa-miR-132	CLIP-seq
MIRT1452821	hsa-miR-204	CLIP-seq
MIRT1452822	hsa-miR-211	CLIP-seq
MIRT1452823	hsa-miR-212	CLIP-seq
MIRT1452830	hsa-miR-3116	CLIP-seq
MIRT1452832	hsa-miR-3180-5p	CLIP-seq
MIRT1452833	hsa-miR-3189-5p	CLIP-seq
MIRT2356760	hsa-miR-3690	CLIP-seq
MIRT2694110	hsa-miR-3714	CLIP-seq
MIRT1452836	hsa-miR-3907	CLIP-seq
MIRT1452837	hsa-miR-3921	CLIP-seq
MIRT1452838	hsa-miR-4287	CLIP-seq
MIRT2694111	hsa-miR-4320	CLIP-seq
MIRT1452839	hsa-miR-4323	CLIP-seq
MIRT2135624	hsa-miR-4421	CLIP-seq
MIRT1452841	hsa-miR-4424	CLIP-seq
MIRT2356761	hsa-miR-4511	CLIP-seq
MIRT2356763	hsa-miR-4650-5p	CLIP-seq
MIRT1452845	hsa-miR-4653-5p	CLIP-seq
MIRT1452846	hsa-miR-4685-3p	CLIP-seq
MIRT2650245	hsa-miR-4714-3p	CLIP-seq
MIRT2135630	hsa-miR-4725-5p	CLIP-seq
MIRT2650246	hsa-miR-4766-5p	CLIP-seq
MIRT1452848	hsa-miR-4768-5p	CLIP-seq
MIRT1452849	hsa-miR-4773	CLIP-seq
MIRT2135631	hsa-miR-500a	CLIP-seq
MIRT2135632	hsa-miR-504	CLIP-seq
MIRT1452853	hsa-miR-520a-5p	CLIP-seq
MIRT2462321	hsa-miR-520d-5p	CLIP-seq
MIRT2462324	hsa-miR-524-5p	CLIP-seq
MIRT1452854	hsa-miR-525-5p	CLIP-seq
MIRT1452855	hsa-miR-526b	CLIP-seq
MIRT2694112	hsa-miR-548an	CLIP-seq
MIRT2694113	hsa-miR-548m	CLIP-seq
MIRT2650247	hsa-miR-563	CLIP-seq
MIRT2356767	hsa-miR-711	CLIP-seq
MIRT1452857	hsa-miR-875-5p	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
ATF4	Activation	15775988
ATF4	Unknown	20592469;21220698
DDIT3	Activation	15775988;18940792
RELA	Repression	12736262

Show/Hide all (48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15775988
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0003714	Function	Transcription corepressor activity	ISS
GO:0004860	Function	Protein kinase inhibitor activity	IDA	15299019
GO:0004860	Function	Protein kinase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	12743605, 15775988, 16147992, 17872950, 20211142, 23455924, 25416956, 25910212, 32296183, 32814053, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0010506	Process	Regulation of autophagy	IEA
GO:0010506	Process	Regulation of autophagy	ISS
GO:0010827	Process	Regulation of D-glucose transmembrane transport	IEA
GO:0010827	Process	Regulation of D-glucose transmembrane transport	ISS	12791994
GO:0016301	Function	Kinase activity	IDA	12743605
GO:0019899	Function	Enzyme binding	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	12791994, 15299019
GO:0019901	Function	Protein kinase binding	ISS
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	IDA	12791994
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	ISS	16794074
GO:0031434	Function	Mitogen-activated protein kinase kinase binding	IBA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	ISS	16794074
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	ISS	12791994
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	15775988
GO:0043405	Process	Regulation of MAP kinase activity	IDA	15299019
GO:0043409	Process	Negative regulation of MAPK cascade	IMP	15299019
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS	17576771
GO:0045717	Process	Negative regulation of fatty acid biosynthetic process	IEA
GO:0045717	Process	Negative regulation of fatty acid biosynthetic process	ISS	16794074
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	15775988
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IDA	12791994
GO:0055106	Function	Ubiquitin-protein transferase regulator activity	IEA
GO:0055106	Function	Ubiquitin-protein transferase regulator activity	ISS	20410507
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IDA	15775988
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	22934019
GO:1990757	Function	Ubiquitin ligase activator activity	IEA
GO:1990757	Function	Ubiquitin ligase activator activity	ISS	16794074

MIM	HGNC	e!Ensembl
607898	16228	ENSG00000101255

Q96RU7

Protein name

Tribbles homolog 3 (TRB-3) (Neuronal cell death-inducible putative kinase) (SINK) (p65-interacting inhibitor of NF-kappa-B)

Protein function

Inactive protein kinase which acts as a regulator of the integrated stress response (ISR), a process for adaptation to various stress (PubMed:15775988, PubMed:15781252). Inhibits the transcriptional activity of DDIT3/CHOP and is involved in DDIT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	78 → 315	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highest expression in liver, pancreas, peripheral blood leukocytes and bone marrow. Also highly expressed in a number of primary lung, colon and breast tumors. Expressed in spleen, thymus, and prostate and is undetectable in other exam

Sequence

MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRAT
AVATASRLGPYVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV
ARPTEVLAGTQLLYAFFTRTHGDMHSLVRSRHRIPEPEAAVLFRQMATALAHCHQHGLVL
RDLKLCRFVFADRERKKLVLENLEDSCVLTGPDDSLWDKHACPAYVGPEILSSRASYSGK
AADVWSLGVALFTMLAGHYPFQDSEPVLLFGKIRRGAYALPAGLSAPARCLVRCLLRREP
AERLTATGILLHPWLRQDPMPLAPTRSHLWEAAQVVPDGLGLDEAREEEGDREVVLYG

Sequence length

358

Interactions

View interactions

	KEGG		Reactome
	Insulin resistance		PIP3 activates AKT signaling Activation of AKT2 PPARA activates gene expression Negative regulation of the PI3K/AKT network CD28 dependent PI3K/Akt signaling VEGFR2 mediated vascular permeability

TRIB3 (tribbles pseudokinase 3)