PTPN4 (protein tyrosine phosphatase non-receptor type 4)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 5775
Gene name Protein tyrosine phosphatase non-receptor type 4
Gene symbol PTPN4
Synonyms (NCBI Gene)
MEGPTPMEGPTPMEG1
Chromosome 2
Chromosome location 2q14.2
Summary The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic tran
miRNA miRNA information provided by mirtarbase database.
793
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (793)
miRTarBase ID miRNA Experiments Reference
MIRT020328 hsa-miR-130b-3p Sequencing 20371350
MIRT025984 hsa-miR-148a-3p Sequencing 20371350
MIRT028116 hsa-miR-93-5p Sequencing 20371350
MIRT031282 hsa-miR-19b-3p Sequencing 20371350
MIRT700509 hsa-miR-4438 HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (22)
GO ID Ontology Definition Evidence Reference
GO:0004721 Function Phosphoprotein phosphatase activity IEA
GO:0004725 Function Protein tyrosine phosphatase activity IBA
GO:0004725 Function Protein tyrosine phosphatase activity IEA
GO:0004726 Function Non-membrane spanning protein tyrosine phosphatase activity IEA
GO:0004726 Function Non-membrane spanning protein tyrosine phosphatase activity TAS 1648233
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
176878 9656 ENSG00000088179
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P29074
Protein name Tyrosine-protein phosphatase non-receptor type 4 (EC 3.1.3.48) (Protein-tyrosine phosphatase MEG1) (MEG) (PTPase-MEG1)
Protein function Phosphatase that plays a role in immunity, learning, synaptic plasticity or cell homeostasis (PubMed:25825441, PubMed:27246854). Regulates neuronal cell homeostasis by protecting neurons against apoptosis (PubMed:20086240). Negatively regulates
PDB 2CS5 , 2I75 , 2VPH , 3NFK , 3NFL , 5EYZ , 5EZ0 , 7VZE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09379 FERM_N 33 → 97 FERM N-terminal domain Domain
PF00373 FERM_M 113 → 222 FERM central domain Domain
PF09380 FERM_C 226 → 316 FERM C-terminal PH-like domain Domain
PF08736 FA 323 → 366 FERM adjacent (FA) Family
PF00595 PDZ 517 → 602 PDZ domain Domain
PF00102 Y_phosphatase 679 → 910 Protein-tyrosine phosphatase Domain
Sequence 
MTSRFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFKVNKHDQGQVLLDVVFK
HLDLTEQDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSPYSLNFRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLPCPSNTAALLASFAVQSELGDYDQSENLSGYLSDYSFIPNQ
PQDFEKEIAKLHQQHIGLSPAEAEFNYLNTARTLELYGVEFHYARDQSNNEIMIGVMSGG
ILIYKNRVRMNTFPWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPS
KPLARKLMDWEVVSRNSISDDRLETQSLPSRSPPGTPNHRNSTFTQEGTRLRPSSVGHLV
DHMVHTSPSEVFVNQRSPSSTQANSIVLESSPSQETPGDGKPPALPPKQSKKNSWNQIHY
SHSQQDLESHINETFDIPSSPEKPTPNGGIPHDNLVLIRMKPDENGRFGFNVKGGYDQKM
PVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELMLL
VRPNAVYDVVEEKLENEPDFQYIPEKAPLDSVHQDDHSLRESMIQLAEGLITGTVLTQFD
QLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSII
NQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQ
VTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNK
RAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQ
YRFVCEAILKVYEEGFVKPLTTSTNK
Sequence length 926
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Toll Like Receptor 4 (TLR4) Cascade
Interleukin-37 signaling
MECP2 regulates neuronal receptors and channels
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
17
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (4)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Intellectual disability Likely pathogenic rs1679218434 RCV001293771
Neurodevelopmental disorder Pathogenic; Likely pathogenic rs2105059931, rs1677776275 RCV002273316
RCV004594847
Papillary renal cell carcinoma type 1 Likely pathogenic rs147418905 RCV005926975
PTPN4-related disorder Pathogenic rs1451229797 RCV003994510
Show/Hide Unknown Diseases (3)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Malignant tumor of urinary bladder Uncertain significance rs141362505 RCV005928891
PTPN4-associated disorder Uncertain significance rs2467092150 RCV003494084
PTPN4-related Neurodevelopmental Disorder Uncertain significance rs1679434397 RCV004799412
Show/Hide Text Mining Associations (4)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Glioblastoma Associate 22000519
Multiple Myeloma Associate 37775746
Prostatic Neoplasms Associate 36042375
Stomach Neoplasms Associate 16619586