Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57727
Gene name Gene Name - the full gene name approved by the HGNC.
Nuclear receptor coactivator 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NCOA5
Synonyms (NCBI Gene) Gene synonyms aliases
CIA, bA465L10.6
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a coregulator for the alpha and beta estrogen receptors and the orphan nuclear receptor NR1D2. The protein localizes to the nucleus, and is thought to have both coactivator and corepressor functions. Its interaction with nuclear receptor
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT051979 hsa-let-7b-5p CLASH 23622248
MIRT499974 hsa-miR-6813-3p PAR-CLIP 24398324
MIRT499973 hsa-miR-3919 PAR-CLIP 24398324
MIRT499972 hsa-miR-4756-3p PAR-CLIP 24398324
MIRT499971 hsa-miR-212-5p PAR-CLIP 24398324
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II NAS 25755249
GO:0003682 Function Chromatin binding IEA
GO:0003714 Function Transcription corepressor activity NAS 25755249
GO:0003723 Function RNA binding HDA 22681889
GO:0005515 Function Protein binding IPI 11113208
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616825 15909 ENSG00000124160
Protein
UniProt ID Q9HCD5
Protein name Nuclear receptor coactivator 5 (NCoA-5) (Coactivator independent of AF-2) (CIA)
Protein function Nuclear receptor coregulator that can have both coactivator and corepressor functions. Interacts with nuclear receptors for steroids (ESR1 and ESR2) independently of the steroid binding domain (AF-2) of the ESR receptors, and with the orphan nuc
PDB 1V95 , 2J7X , 2J7Y , 4ZI1
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed.
Sequence
MNTAPSRPSPTRRDPYGFGDSRDSRRDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDL
RDHRHSRDLRDHRDSRSVRDVRDVRDLRDFRDLRDSRDFRDQRDPMYDRYRDMRDSRDPM
YRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREEL
YRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQ
ALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNE
CREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEET
DKIINYLRERKERLMRSSTDSLPGPISRQPLGATSGASLKTQPSSQPLQSGQVLPSATPT
PSAPPTSQQELQAKILSLFNSGTVTANSSSASPSVAAGNTPNQNFSTAANSQPQQRSQAS
GNQPPSILGQGGSAQNMGPRPGAPSQGLFGQPSSRLAPASNMTSQRPVSSTGINFDNPSV
QKALDTLIQSGPALSHLVSQTTAQMGQPQAPMGSYQRHY
Sequence length 579
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Diffuse lymphoma Diffuse Large B-Cell Lymphoma rs121912651, rs121913289, rs121913293, rs878854402, rs869025340, rs1349928568, rs1569115687, rs121913291 31407831
Multiple sclerosis Multiple Sclerosis rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039
View all (4 more)
21833088, 31407831
Unknown
Disease term Disease name Evidence References Source
Mental depression Major Depressive Disorder 29942085 ClinVar
Neuroticism Neuroticism GWAS
Multiple Sclerosis Multiple Sclerosis GWAS
Metabolic Syndrome Metabolic Syndrome GWAS