Gene Gene information from NCBI Gene database.
Entrez ID 5771
Gene name Protein tyrosine phosphatase non-receptor type 2
Gene symbol PTPN2
Synonyms (NCBI Gene)
PTN2PTPTTC-PTPTC45TC48TCELLPTPTCPTP
Chromosome 18
Chromosome location 18p11.21
Summary The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that
miRNA miRNA information provided by mirtarbase database.
227
miRTarBase ID miRNA Experiments Reference
MIRT054248 hsa-miR-210-3p ChipLuciferase reporter assayQRTPCRWestern blot 23579275
MIRT450163 hsa-miR-1264 PAR-CLIP 22100165
MIRT450162 hsa-miR-520d-5p PAR-CLIP 22100165
MIRT450161 hsa-miR-524-5p PAR-CLIP 22100165
MIRT450163 hsa-miR-1264 HITS-CLIP 27418678
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
93
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0004721 Function Phosphoprotein phosphatase activity IEA
GO:0004725 Function Protein tyrosine phosphatase activity EXP 12138178
GO:0004725 Function Protein tyrosine phosphatase activity IDA 12138178, 12612081, 17210636, 23006999
GO:0004725 Function Protein tyrosine phosphatase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
176887 9650 ENSG00000175354
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P17706
Protein name Tyrosine-protein phosphatase non-receptor type 2 (EC 3.1.3.48) (T-cell protein-tyrosine phosphatase) (TCPTP)
Protein function Non-receptor type tyrosine-specific phosphatase that dephosphorylates receptor protein tyrosine kinases including INSR, EGFR, CSF1R, PDGFR. Also dephosphorylates non-receptor protein tyrosine kinases like JAK1, JAK2, JAK3, Src family kinases, ST
PDB 1L8K , 6ZZ4 , 7F5N , 7F5O , 7UAD , 8U0H , 8UH6 , 9C54 , 9C55 , 9C56
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00102 Y_phosphatase 42 274 Protein-tyrosine phosphatase Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. Isoform 2 is probably the major isoform. Isoform 1 is expressed in T-cells and in placenta. {ECO:0000269|PubMed:1731319, ECO:0000269|PubMed:2546150}.
Sequence
MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIE
GAKCIKGDSSIQKRWKELSKEDLSPA
FDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKAT
TAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL
Sequence length 415
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  JAK-STAT signaling pathway   Negative regulation of MET activity
Regulation of IFNG signaling
Interleukin-37 signaling