Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5771
Gene name Gene Name - the full gene name approved by the HGNC.	Protein tyrosine phosphatase non-receptor type 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PTPN2
Synonyms (NCBI Gene) Gene synonyms aliases	PTN2, PTPT, TC-PTP, TC45, TC48, TCELLPTP, TCPTP
Chromosome Chromosome number	18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	18p11.21
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that

Show/Hide all(227)

miRTarBase ID	miRNA	Experiments	Reference
MIRT054248	hsa-miR-210-3p	Chip, Luciferase reporter assay, QRTPCR, Western blot	23579275
MIRT450163	hsa-miR-1264	PAR-CLIP	22100165
MIRT450162	hsa-miR-520d-5p	PAR-CLIP	22100165
MIRT450161	hsa-miR-524-5p	PAR-CLIP	22100165
MIRT450163	hsa-miR-1264	HITS-CLIP	27418678
MIRT450163	hsa-miR-1264	HITS-CLIP	27418678
MIRT450163	hsa-miR-1264	PAR-CLIP	22100165
MIRT450162	hsa-miR-520d-5p	PAR-CLIP	22100165
MIRT450161	hsa-miR-524-5p	PAR-CLIP	22100165
MIRT1275415	hsa-miR-105	CLIP-seq
MIRT1275416	hsa-miR-1297	CLIP-seq
MIRT1275417	hsa-miR-1307	CLIP-seq
MIRT1275418	hsa-miR-205	CLIP-seq
MIRT1275419	hsa-miR-26a	CLIP-seq
MIRT1275420	hsa-miR-26b	CLIP-seq
MIRT1275421	hsa-miR-3145-3p	CLIP-seq
MIRT1275422	hsa-miR-3148	CLIP-seq
MIRT1275423	hsa-miR-3671	CLIP-seq
MIRT1275424	hsa-miR-4284	CLIP-seq
MIRT1275425	hsa-miR-4465	CLIP-seq
MIRT1275426	hsa-miR-4468	CLIP-seq
MIRT1275427	hsa-miR-4496	CLIP-seq
MIRT1275428	hsa-miR-4532	CLIP-seq
MIRT1275429	hsa-miR-4638-5p	CLIP-seq
MIRT1275430	hsa-miR-4760-3p	CLIP-seq
MIRT1275431	hsa-miR-4772-3p	CLIP-seq
MIRT1275432	hsa-miR-4775	CLIP-seq
MIRT1275433	hsa-miR-501-3p	CLIP-seq
MIRT1275434	hsa-miR-502-3p	CLIP-seq
MIRT1275435	hsa-miR-548ae	CLIP-seq
MIRT1275436	hsa-miR-548aj	CLIP-seq
MIRT1275437	hsa-miR-548am	CLIP-seq
MIRT1275438	hsa-miR-548x	CLIP-seq
MIRT1275439	hsa-miR-590-3p	CLIP-seq
MIRT1275440	hsa-miR-607	CLIP-seq
MIRT1275441	hsa-miR-651	CLIP-seq
MIRT1275442	hsa-miR-664	CLIP-seq
MIRT1275443	hsa-miR-767-5p	CLIP-seq
MIRT1275444	hsa-miR-155	CLIP-seq
MIRT1275445	hsa-miR-548l	CLIP-seq
MIRT1275446	hsa-miR-548n	CLIP-seq
MIRT1275447	hsa-miR-1180	CLIP-seq
MIRT1275448	hsa-miR-1203	CLIP-seq
MIRT1275449	hsa-miR-1294	CLIP-seq
MIRT1275450	hsa-miR-1827	CLIP-seq
MIRT1275451	hsa-miR-216a	CLIP-seq
MIRT1275452	hsa-miR-216b	CLIP-seq
MIRT1275453	hsa-miR-30a	CLIP-seq
MIRT1275454	hsa-miR-30b	CLIP-seq
MIRT1275455	hsa-miR-30c	CLIP-seq
MIRT1275456	hsa-miR-30d	CLIP-seq
MIRT1275457	hsa-miR-30e	CLIP-seq
MIRT1275458	hsa-miR-331-3p	CLIP-seq
MIRT1275459	hsa-miR-338-5p	CLIP-seq
MIRT1275460	hsa-miR-34a	CLIP-seq
MIRT1275461	hsa-miR-34c-5p	CLIP-seq
MIRT1275462	hsa-miR-3907	CLIP-seq
MIRT1275463	hsa-miR-4308	CLIP-seq
MIRT1275464	hsa-miR-431	CLIP-seq
MIRT1275465	hsa-miR-4316	CLIP-seq
MIRT1275466	hsa-miR-4417	CLIP-seq
MIRT1275467	hsa-miR-4481	CLIP-seq
MIRT1275468	hsa-miR-4495	CLIP-seq
MIRT1275469	hsa-miR-449a	CLIP-seq
MIRT1275470	hsa-miR-449b	CLIP-seq
MIRT1275471	hsa-miR-4664-3p	CLIP-seq
MIRT1275472	hsa-miR-4677-3p	CLIP-seq
MIRT1275473	hsa-miR-4698	CLIP-seq
MIRT1275474	hsa-miR-4735-5p	CLIP-seq
MIRT1275475	hsa-miR-4745-5p	CLIP-seq
MIRT1275476	hsa-miR-4764-5p	CLIP-seq
MIRT1275477	hsa-miR-495	CLIP-seq
MIRT1275478	hsa-miR-507	CLIP-seq
MIRT1275479	hsa-miR-518d-5p	CLIP-seq
MIRT1275480	hsa-miR-519b-5p	CLIP-seq
MIRT1275481	hsa-miR-519c-5p	CLIP-seq
MIRT1275482	hsa-miR-520c-5p	CLIP-seq
MIRT1275483	hsa-miR-526a	CLIP-seq
MIRT1275484	hsa-miR-548a-5p	CLIP-seq
MIRT1275485	hsa-miR-548ab	CLIP-seq
MIRT1275486	hsa-miR-548ac	CLIP-seq
MIRT1275435	hsa-miR-548ae	CLIP-seq
MIRT1275436	hsa-miR-548aj	CLIP-seq
MIRT1275487	hsa-miR-548ak	CLIP-seq
MIRT1275437	hsa-miR-548am	CLIP-seq
MIRT1275488	hsa-miR-548b-5p	CLIP-seq
MIRT1275489	hsa-miR-548c-5p	CLIP-seq
MIRT1275490	hsa-miR-548d-3p	CLIP-seq
MIRT1275491	hsa-miR-548d-5p	CLIP-seq
MIRT1275492	hsa-miR-548h	CLIP-seq
MIRT1275493	hsa-miR-548i	CLIP-seq
MIRT1275494	hsa-miR-548j	CLIP-seq
MIRT1275495	hsa-miR-548w	CLIP-seq
MIRT1275438	hsa-miR-548x	CLIP-seq
MIRT1275496	hsa-miR-548y	CLIP-seq
MIRT1275497	hsa-miR-548z	CLIP-seq
MIRT1275498	hsa-miR-557	CLIP-seq
MIRT1275499	hsa-miR-559	CLIP-seq
MIRT1275500	hsa-miR-561	CLIP-seq
MIRT1275501	hsa-miR-578	CLIP-seq
MIRT1275502	hsa-miR-643	CLIP-seq
MIRT2081102	hsa-miR-192	CLIP-seq
MIRT2081103	hsa-miR-215	CLIP-seq
MIRT2081104	hsa-miR-223	CLIP-seq
MIRT2081105	hsa-miR-33a	CLIP-seq
MIRT2081106	hsa-miR-33b	CLIP-seq
MIRT2081107	hsa-miR-3923	CLIP-seq
MIRT2081108	hsa-miR-4454	CLIP-seq
MIRT2081109	hsa-miR-4697-3p	CLIP-seq
MIRT2081110	hsa-miR-4707-3p	CLIP-seq
MIRT2081111	hsa-miR-4731-5p	CLIP-seq
MIRT2081112	hsa-miR-935	CLIP-seq
MIRT1275449	hsa-miR-1294	CLIP-seq
MIRT2306989	hsa-miR-138	CLIP-seq
MIRT1275450	hsa-miR-1827	CLIP-seq
MIRT2306990	hsa-miR-22	CLIP-seq
MIRT2306991	hsa-miR-2276	CLIP-seq
MIRT2306992	hsa-miR-298	CLIP-seq
MIRT1275453	hsa-miR-30a	CLIP-seq
MIRT1275454	hsa-miR-30b	CLIP-seq
MIRT1275455	hsa-miR-30c	CLIP-seq
MIRT1275456	hsa-miR-30d	CLIP-seq
MIRT1275457	hsa-miR-30e	CLIP-seq
MIRT2306993	hsa-miR-3158-5p	CLIP-seq
MIRT2306994	hsa-miR-3182	CLIP-seq
MIRT1275462	hsa-miR-3907	CLIP-seq
MIRT2306995	hsa-miR-4282	CLIP-seq
MIRT1275465	hsa-miR-4316	CLIP-seq
MIRT2306996	hsa-miR-4456	CLIP-seq
MIRT1275472	hsa-miR-4677-3p	CLIP-seq
MIRT1275431	hsa-miR-4772-3p	CLIP-seq
MIRT1275477	hsa-miR-495	CLIP-seq
MIRT2306997	hsa-miR-518a-5p	CLIP-seq
MIRT2306998	hsa-miR-527	CLIP-seq
MIRT2306999	hsa-miR-541	CLIP-seq
MIRT2307000	hsa-miR-544	CLIP-seq
MIRT2307001	hsa-miR-548m	CLIP-seq
MIRT1275500	hsa-miR-561	CLIP-seq
MIRT2307002	hsa-miR-654-5p	CLIP-seq
MIRT2393224	hsa-miR-106a	CLIP-seq
MIRT2393225	hsa-miR-106b	CLIP-seq
MIRT2393226	hsa-miR-125a-3p	CLIP-seq
MIRT2393227	hsa-miR-150	CLIP-seq
MIRT2393228	hsa-miR-17	CLIP-seq
MIRT2393229	hsa-miR-1913	CLIP-seq
MIRT2393230	hsa-miR-20a	CLIP-seq
MIRT2393231	hsa-miR-20b	CLIP-seq
MIRT2393232	hsa-miR-302a	CLIP-seq
MIRT2393233	hsa-miR-302b	CLIP-seq
MIRT2393234	hsa-miR-302c	CLIP-seq
MIRT2393235	hsa-miR-302d	CLIP-seq
MIRT2393236	hsa-miR-302e	CLIP-seq
MIRT2393237	hsa-miR-3157-5p	CLIP-seq
MIRT2393238	hsa-miR-324-3p	CLIP-seq
MIRT2393239	hsa-miR-372	CLIP-seq
MIRT2393240	hsa-miR-373	CLIP-seq
MIRT2393241	hsa-miR-3934	CLIP-seq
MIRT2393242	hsa-miR-4438	CLIP-seq
MIRT2081111	hsa-miR-4731-5p	CLIP-seq
MIRT2393243	hsa-miR-5095	CLIP-seq
MIRT2393244	hsa-miR-512-3p	CLIP-seq
MIRT2393245	hsa-miR-519d	CLIP-seq
MIRT2393246	hsa-miR-520a-3p	CLIP-seq
MIRT2393247	hsa-miR-520b	CLIP-seq
MIRT2393248	hsa-miR-520c-3p	CLIP-seq
MIRT2393249	hsa-miR-520d-3p	CLIP-seq
MIRT2393250	hsa-miR-520e	CLIP-seq
MIRT2393251	hsa-miR-520g	CLIP-seq
MIRT2393252	hsa-miR-520h	CLIP-seq
MIRT2393253	hsa-miR-764	CLIP-seq
MIRT2393254	hsa-miR-93	CLIP-seq
MIRT2457430	hsa-miR-122	CLIP-seq
MIRT2457431	hsa-miR-1249	CLIP-seq
MIRT2457432	hsa-miR-1273f	CLIP-seq
MIRT2457433	hsa-miR-1289	CLIP-seq
MIRT1275416	hsa-miR-1297	CLIP-seq
MIRT1275417	hsa-miR-1307	CLIP-seq
MIRT2457434	hsa-miR-143	CLIP-seq
MIRT2457435	hsa-miR-1976	CLIP-seq
MIRT1275419	hsa-miR-26a	CLIP-seq
MIRT1275420	hsa-miR-26b	CLIP-seq
MIRT2457436	hsa-miR-3064-5p	CLIP-seq
MIRT2457437	hsa-miR-3125	CLIP-seq
MIRT2457438	hsa-miR-3198	CLIP-seq
MIRT2457439	hsa-miR-335	CLIP-seq
MIRT2081105	hsa-miR-33a	CLIP-seq
MIRT2081106	hsa-miR-33b	CLIP-seq
MIRT2457440	hsa-miR-3914	CLIP-seq
MIRT2457441	hsa-miR-3916	CLIP-seq
MIRT2457442	hsa-miR-3928	CLIP-seq
MIRT2457443	hsa-miR-411	CLIP-seq
MIRT2457444	hsa-miR-4279	CLIP-seq
MIRT1275424	hsa-miR-4284	CLIP-seq
MIRT2457445	hsa-miR-4294	CLIP-seq
MIRT2457446	hsa-miR-4309	CLIP-seq
MIRT1275425	hsa-miR-4465	CLIP-seq
MIRT2457447	hsa-miR-4505	CLIP-seq
MIRT2457448	hsa-miR-450b-5p	CLIP-seq
MIRT1275428	hsa-miR-4532	CLIP-seq
MIRT2457449	hsa-miR-4534	CLIP-seq
MIRT1275429	hsa-miR-4638-5p	CLIP-seq
MIRT2457450	hsa-miR-4708-5p	CLIP-seq
MIRT2457451	hsa-miR-4722-3p	CLIP-seq
MIRT1275474	hsa-miR-4735-5p	CLIP-seq
MIRT2457452	hsa-miR-4770	CLIP-seq
MIRT1275431	hsa-miR-4772-3p	CLIP-seq
MIRT1275432	hsa-miR-4775	CLIP-seq
MIRT1275478	hsa-miR-507	CLIP-seq
MIRT1275498	hsa-miR-557	CLIP-seq
MIRT1275439	hsa-miR-590-3p	CLIP-seq
MIRT2457453	hsa-miR-720	CLIP-seq
MIRT2604582	hsa-miR-101	CLIP-seq
MIRT2604583	hsa-miR-144	CLIP-seq
MIRT2604584	hsa-miR-3163	CLIP-seq
MIRT1275460	hsa-miR-34a	CLIP-seq
MIRT1275461	hsa-miR-34c-5p	CLIP-seq
MIRT1275469	hsa-miR-449a	CLIP-seq
MIRT1275470	hsa-miR-449b	CLIP-seq
MIRT2604585	hsa-miR-548c-3p	CLIP-seq
MIRT2604582	hsa-miR-101	CLIP-seq
MIRT2604583	hsa-miR-144	CLIP-seq
MIRT2604584	hsa-miR-3163	CLIP-seq
MIRT1275460	hsa-miR-34a	CLIP-seq
MIRT1275461	hsa-miR-34c-5p	CLIP-seq
MIRT1275469	hsa-miR-449a	CLIP-seq
MIRT1275470	hsa-miR-449b	CLIP-seq
MIRT2604585	hsa-miR-548c-3p	CLIP-seq

Show/Hide all(50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	EXP	12138178
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	12612081
GO:0004725	Function	Protein tyrosine phosphatase activity	IMP	11909529, 14966296
GO:0004726	Function	Non-membrane spanning protein tyrosine phosphatase activity	IEA
GO:0005178	Function	Integrin binding	IPI	15592458
GO:0005515	Function	Protein binding	IPI	12907755, 15696169, 16595549, 22080863
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005783	Component	Endoplasmic reticulum	IDA	10940933
GO:0005793	Component	Endoplasmic reticulum-Golgi intermediate compartment	IDA	23006999
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	15592458
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	15592458
GO:0008286	Process	Insulin receptor signaling pathway	ISS
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	ISS
GO:0010888	Process	Negative regulation of lipid storage	ISS
GO:0019901	Function	Protein kinase binding	IPI	11909529
GO:0019905	Function	Syntaxin binding	IPI	23006999
GO:0030183	Process	B cell differentiation	ISS
GO:0030217	Process	T cell differentiation	ISS
GO:0030218	Process	Erythrocyte differentiation	ISS
GO:0030971	Function	Receptor tyrosine kinase binding	IPI	18819921
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IMP	11909529, 14966296
GO:0042059	Process	Negative regulation of epidermal growth factor receptor signaling pathway	IMP	15592458
GO:0042532	Process	Negative regulation of tyrosine phosphorylation of STAT protein	IMP	12138178
GO:0042593	Process	Glucose homeostasis	ISS
GO:0045650	Process	Negative regulation of macrophage differentiation	ISS
GO:0045722	Process	Positive regulation of gluconeogenesis	ISS
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	ISS
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	ISS
GO:0050922	Process	Negative regulation of chemotaxis	ISS
GO:0060334	Process	Regulation of interferon-gamma-mediated signaling pathway	TAS
GO:0060336	Process	Negative regulation of interferon-gamma-mediated signaling pathway	ISS
GO:0060339	Process	Negative regulation of type I interferon-mediated signaling pathway	IMP	11909529
GO:0061099	Process	Negative regulation of protein tyrosine kinase activity	IEA
GO:0070104	Process	Negative regulation of interleukin-6-mediated signaling pathway	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	ISS
GO:0071345	Process	Cellular response to cytokine stimulus	TAS
GO:0097677	Function	STAT family protein binding	IEA
GO:1902202	Process	Regulation of hepatocyte growth factor receptor signaling pathway	IMP	18819921
GO:1902206	Process	Negative regulation of interleukin-2-mediated signaling pathway	IMP	11909529
GO:1902215	Process	Negative regulation of interleukin-4-mediated signaling pathway	IEA
GO:1902227	Process	Negative regulation of macrophage colony-stimulating factor signaling pathway	ISS
GO:1902233	Process	Negative regulation of positive thymic T cell selection	ISS
GO:1902237	Process	Positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IEA
GO:1903899	Process	Positive regulation of PERK-mediated unfolded protein response	IEA
GO:2000587	Process	Negative regulation of platelet-derived growth factor receptor-beta signaling pathway	ISS

MIM	HGNC	e!Ensembl
176887	9650	ENSG00000175354

Protein

UniProt ID

P17706

Protein name

Tyrosine-protein phosphatase non-receptor type 2 (EC 3.1.3.48) (T-cell protein-tyrosine phosphatase) (TCPTP)

Protein function

Non-receptor type tyrosine-specific phosphatase that dephosphorylates receptor protein tyrosine kinases including INSR, EGFR, CSF1R, PDGFR. Also dephosphorylates non-receptor protein tyrosine kinases like JAK1, JAK2, JAK3, Src family kinases, ST

PDB

1L8K , 6ZZ4 , 7F5N , 7F5O , 7UAD , 8U0H , 8UH6 , 9C54 , 9C55 , 9C56

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00102	Y_phosphatase	42 → 274	Protein-tyrosine phosphatase	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Isoform 2 is probably the major isoform. Isoform 1 is expressed in T-cells and in placenta. {ECO:0000269|PubMed:1731319, ECO:0000269|PubMed:2546150}.

Sequence

MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPA
FDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKAT
TAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL

Sequence length

415

Interactions

View interactions

	KEGG		Reactome
	JAK-STAT signaling pathway		Negative regulation of MET activity Regulation of IFNG signaling Interleukin-37 signaling

Show/Hide Causal Diseases (12)

Disease term	Disease name	dbSNP ID	References
Causal
Apraxia	Apraxias	rs121908377, rs121908378, rs1135401820, rs1178491246, rs1584969672
Arthritis	Systemic onset juvenile chronic arthritis, Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	23603761, 22354554
Autoimmune diseases	Autoimmune Diseases, AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1, AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 2	rs869025224	21383967, 30595370
Carcinoma	Squamous cell carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	22960999
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	25751624, 19430480, 21980299
Esophagus neoplasm	Esophageal Neoplasms	rs28934578, rs121918714, rs1567556006, rs1575166666	22960999
Immunoglobulin a deficiency	Immunoglobulin A deficiency (disorder)	rs72553883, rs72553882, rs144718007	27723758
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468	28067908, 23128233, 26192919
Lymphoblastic leukemia	Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	rs387906351, rs104894562, rs398122513, rs398122840, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699 View all (13 more)	20473312
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039 View all (4 more)	22190364
Psoriasis	Psoriasis	rs281875215, rs587777763, rs281875213, rs281875212	26974007, 28537254
Rheumatoid arthritis	Rheumatoid Arthritis, Rheumatoid Arthritis, Systemic Juvenile	rs587776843	30423114, 22446963, 26546613, 24390342, 24532676, 23603761

Show/Hide Unknown Diseases (11)

Disease term	Disease name	Evidence	References	Source
Unknown
Asthma	Asthma		21150878	ClinVar
Celiac disease	Celiac Disease, Celiac disease		23143596, 26546613, 22057235, 20190752	ClinVar, GWAS
Crohn disease	Crohn Disease, Regional enteritis, NON RARE IN EUROPE: Crohn disease		18587394, 25489960, 21102463, 26974007, 28067908, 26192919, 17554261, 21298027	ClinVar
Diabetes	Diabetes			GWAS
Crohn Disease	Crohn Disease			GWAS
Hypothyroidism	Hypothyroidism			GWAS
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.		GWAS, CBGDA
Inflammatory Bowel Disease	Inflammatory Bowel Disease			GWAS
Ulcerative colitis	Ulcerative colitis			GWAS
Prostate cancer	Prostate cancer	Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population.		GWAS, CBGDA
Vitiligo	Vitiligo			GWAS

Show/Hide Text Mining Associations (71)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenoma Islet Cell	Associate	22315323, 22960018
Albuminuria	Associate	30246029
Alzheimer Disease	Associate	29684019
Antiphospholipid Syndrome	Associate	30471352
Arthritis Juvenile	Associate	20722033, 22294642, 23603761, 24886659, 30940621
Arthritis Rheumatoid	Associate	21452313, 23577190, 25652333, 28107378, 29398253, 29423382, 34445589
Ataxia Telangiectasia	Associate	21551237, 31270080
ATR X syndrome	Associate	37812190
Autoimmune Diseases	Associate	20722033, 26040922, 29398253, 30471352, 31722988
Autoimmune Diseases of the Nervous System	Associate	39959585
Autoimmune enteropathy	Associate	34806245
Breast Neoplasms	Associate	26208487, 30515568, 31025094
Carcinoma Hepatocellular	Associate	19140237, 34057016
CD59 Deficiency	Associate	34623321
Celiac Disease	Associate	19073967
Chromosome 18p deletion syndrome	Associate	30122583
Colitis Ulcerative	Associate	21830272, 22457781, 26928573
Colonic Diseases	Associate	21830272
Colorectal Neoplasms	Associate	32207560
Congenital Abnormalities	Associate	37537852
Crohn Disease	Associate	19818778, 20117335, 20736230, 21548950, 21818367, 21830272, 22377701, 22457781, 22671596, 24901824, 25489960, 26928573, 29423382, 29456405, 29965986, 34198814, 34445589, 37537852 View all (3 more)
Diabetes Mellitus	Associate	32207560, 38241313
Diabetes Mellitus Type 1	Associate	21429197, 22960018, 26224887, 26344020, 29343548, 29398253, 31030572, 33193091, 35812428, 36497105
Diabetes Mellitus Type 2	Associate	30246029
Diabetic Angiopathies	Associate	33193091
Gallstones	Associate	26928573
Genetic Diseases Inborn	Associate	22457781, 30122583
Glioblastoma	Stimulate	29764444
Glioma	Associate	29764444, 37812190
Hematologic Diseases	Associate	37884566, 39959585
Hodgkin Disease	Associate	21791476
Immunologic Deficiency Syndromes	Inhibit	39959585
Inflammation	Associate	24022492, 25652333, 26040922, 29423382, 29456405, 29764444, 29965986, 30246029, 31248982, 32031616, 32652144, 34445589, 34806245
Inflammation	Stimulate	32373968
Inflammatory Bowel Diseases	Associate	22377701, 22457781, 22671596, 24022492, 24901824, 26928573, 27824650, 29398253, 29965986, 32031616, 32652144, 34623321
Intestinal Diseases	Associate	28804910
Joint Diseases	Associate	27342690
Leukemia	Associate	31248982
Leukemia B Cell	Associate	15591113
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	15539083
Leukemia Myeloid Acute	Associate	37884566
Lung Diseases Interstitial	Associate	39959585
Lung Neoplasms	Associate	28400551
Lupus Erythematosus Systemic	Stimulate	31616406
Lymphatic Diseases	Associate	39959585
Lymphatic Metastasis	Associate	19140237
Lymphoma	Associate	31248982
Lymphoma Large B Cell Diffuse	Associate	17210636
Lymphoma Non Hodgkin	Associate	21791476
Lymphoma T Cell	Associate	21791476, 26040922
Lymphoma T Cell Peripheral	Associate	21791476
Macrophage Activation Syndrome	Associate	32652144
Neoplasm Metastasis	Associate	35154122
Neoplasms	Stimulate	17210636
Neoplasms	Associate	19922411, 29764444, 30515568, 33122197, 36973833, 7693671
Neoplasms	Inhibit	21791476, 26040922, 26208487, 31025094, 31270080
Neuroblastoma	Associate	21876762
Osteogenesis imperfecta type 2A	Associate	31030572
Ovarian Neoplasms	Associate	39179931
Pancreatic Neoplasms	Associate	33122197, 35154122
Periapical Diseases	Associate	39446923
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	28671688
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	21551237, 31270080
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	21791476
Primary Immunodeficiency Diseases	Associate	32499645
Renal Insufficiency	Associate	37537852
Stomatitis Aphthous	Associate	26928573
Thyroid Cancer Papillary	Associate	32285621
Thyroiditis Autoimmune	Associate	19951419
Turner Syndrome	Associate	30122583
Uveitis	Associate	26928573

PTPN2 (protein tyrosine phosphatase non-receptor type 2)