Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5764
Gene name Gene Name - the full gene name approved by the HGNC.	Pleiotrophin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PTN
Synonyms (NCBI Gene) Gene synonyms aliases	HARP, HB-GAM, HBBM, HBGF-8, HBGF8, HBNF, HBNF-1, NEGF1, OSF-1
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q33
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a secreted heparin-binding growth factor. The protein has significant roles in cell growth and survival, cell migration, angiogenesis and tumorigenesis. Alternative splicing and the use of alternative promoters results

Show/Hide all(9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT437648	hsa-miR-155-5p	Microarray, qRT-PCR	22815788
MIRT1273762	hsa-miR-302f	CLIP-seq
MIRT1273763	hsa-miR-3143	CLIP-seq
MIRT1273764	hsa-miR-376c	CLIP-seq
MIRT1273765	hsa-miR-543	CLIP-seq
MIRT2306637	hsa-miR-3613-3p	CLIP-seq
MIRT2306638	hsa-miR-607	CLIP-seq
MIRT2604353	hsa-miR-2964a-5p	CLIP-seq
MIRT2604354	hsa-miR-628-5p	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
HOXA5	Activation	15757903
JUN	Activation	16199533
SP1	Unknown	10962555

Show/Hide all(82)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IEA
GO:0002232	Process	Leukocyte chemotaxis involved in inflammatory response	IEA
GO:0002232	Process	Leukocyte chemotaxis involved in inflammatory response	ISS
GO:0002690	Process	Positive regulation of leukocyte chemotaxis	IEA
GO:0002690	Process	Positive regulation of leukocyte chemotaxis	ISS
GO:0004864	Function	Protein phosphatase inhibitor activity	IDA	27445335
GO:0004864	Function	Protein phosphatase inhibitor activity	TAS	10706604
GO:0005178	Function	Integrin binding	IPI	19141530
GO:0005515	Function	Protein binding	IPI	10706604, 19141530, 21344482, 28939773, 32296183, 32814053
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	1733956
GO:0005615	Component	Extracellular space	TAS	10706604
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0007185	Process	Cell surface receptor protein tyrosine phosphatase signaling pathway	TAS	10706604
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	19141530
GO:0007399	Process	Nervous system development	TAS	2270483
GO:0007406	Process	Negative regulation of neuroblast proliferation	IEA
GO:0007406	Process	Negative regulation of neuroblast proliferation	ISS
GO:0007612	Process	Learning	IEA
GO:0007612	Process	Learning	ISS
GO:0007613	Process	Memory	IEA
GO:0007613	Process	Memory	ISS
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	1733956
GO:0008083	Function	Growth factor activity	IEA
GO:0008201	Function	Heparin binding	IDA	1733956
GO:0008201	Function	Heparin binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	1733956
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	2270483
GO:0010594	Process	Regulation of endothelial cell migration	ISS
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0010996	Process	Response to auditory stimulus	IEA
GO:0010996	Process	Response to auditory stimulus	ISS
GO:0019901	Function	Protein kinase binding	IPI	20873783
GO:0030246	Function	Carbohydrate binding	EXP	26896299
GO:0030282	Process	Bone mineralization	IEA
GO:0030501	Process	Positive regulation of bone mineralization	IEA
GO:0030501	Process	Positive regulation of bone mineralization	ISS
GO:0031104	Process	Dendrite regeneration	ISS
GO:0031641	Process	Regulation of myelination	IEA
GO:0031641	Process	Regulation of myelination	ISS
GO:0032991	Component	Protein-containing complex	IDA	20873783
GO:0035374	Function	Chondroitin sulfate binding	IDA	26896299
GO:0042246	Process	Tissue regeneration	IEA
GO:0042246	Process	Tissue regeneration	ISS
GO:0043113	Process	Receptor clustering	IDA	27445335
GO:0043932	Process	Ossification involved in bone remodeling	IDA	19442624
GO:0044849	Process	Estrous cycle	IEA
GO:0044849	Process	Estrous cycle	ISS
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045778	Process	Positive regulation of ossification	ISS
GO:0046697	Process	Decidualization	IEA
GO:0046697	Process	Decidualization	ISS
GO:0048167	Process	Regulation of synaptic plasticity	IEA
GO:0048167	Process	Regulation of synaptic plasticity	ISS
GO:0048477	Process	Oogenesis	IEA
GO:0048477	Process	Oogenesis	ISS
GO:0048680	Process	Positive regulation of axon regeneration	ISS
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IDA	27445335
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IMP	30667096
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0140059	Process	Dendrite arborization	IEA
GO:0140059	Process	Dendrite arborization	ISS
GO:0140677	Function	Molecular function activator activity	IPI	21344482
GO:1900006	Process	Positive regulation of dendrite development	IEA
GO:1900006	Process	Positive regulation of dendrite development	ISS
GO:1900272	Process	Negative regulation of long-term synaptic potentiation	IEA
GO:1900272	Process	Negative regulation of long-term synaptic potentiation	ISS
GO:1903706	Process	Regulation of hemopoiesis	IEA
GO:1903706	Process	Regulation of hemopoiesis	ISS
GO:2000036	Process	Regulation of stem cell population maintenance	IEA
GO:2000036	Process	Regulation of stem cell population maintenance	ISS
GO:2000347	Process	Positive regulation of hepatocyte proliferation	IEA
GO:2000347	Process	Positive regulation of hepatocyte proliferation	ISS
GO:2000738	Process	Positive regulation of stem cell differentiation	IEA
GO:2000738	Process	Positive regulation of stem cell differentiation	ISS

MIM	HGNC	e!Ensembl
162095	9630	ENSG00000105894

Protein

UniProt ID

P21246

Protein name

Pleiotrophin (PTN) (Heparin-binding brain mitogen) (HBBM) (Heparin-binding growth factor 8) (HBGF-8) (Heparin-binding growth-associated molecule) (HB-GAM) (Heparin-binding neurite outgrowth-promoting factor) (HBNF) (Heparin-binding neurite outgrowth-promo

Protein function

Secreted growth factor that mediates its signal through cell-surface proteoglycan and non-proteoglycan receptors (PubMed:11278720, PubMed:16814777, PubMed:19141530). Binds cell-surface proteoglycan receptor via their chondroitin sulfate (CS) gro

PDB

2N6F , 8VOH , 8VOI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05196	PTN_MK_N	34 → 95	PTN/MK heparin-binding protein family, N-terminal domain	Domain
PF01091	PTN_MK_C	96 → 161	PTN/MK heparin-binding protein family, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Osteoblast and brain. {ECO:0000269|PubMed:1701634}.

Sequence

MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSG
DCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTG
SLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

Sequence length

168

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (55)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	23056589
Alzheimer Disease	Associate	29042634
Aneuploidy	Stimulate	17067552
Arrest of spermatogenesis	Associate	39241251, 39285301
Astrocytoma	Associate	23349846
Azoospermia	Associate	39285301
Breast Neoplasms	Associate	1733956, 17490616, 17706593, 30497491
Breast Neoplasms	Stimulate	40604866
Carcinoma Hepatocellular	Associate	28557334
Carcinoma Non Small Cell Lung	Associate	21170350
Carcinoma Ovarian Epithelial	Associate	25418856
Cataract Age Related Nuclear	Associate	33213085
Cell Transformation Neoplastic	Associate	25418856
Chondrosarcoma	Associate	12681952
Communication Disorders	Associate	36829233
COVID 19	Inhibit	35967328
COVID 19	Associate	36829233
Death	Associate	37960806
Endometrial Neoplasms	Associate	35169075
Epiretinal Membrane	Associate	25617851
Fatty Liver	Associate	28557334
Glioblastoma	Associate	15908427, 17067552, 35327982
Glioma	Associate	15684595, 29531016, 32372724, 40604866
Glioma of Brain Familial	Associate	29531016
Immune System Diseases	Associate	32153561
Infertility Male	Associate	39285301
Inflammation	Associate	12681952, 32153561
Lung Neoplasms	Associate	20639902
Lupus Erythematosus Systemic	Associate	21437871, 32153561
Lymphatic Metastasis	Stimulate	37960806
Megalodactyly	Stimulate	22848377
Melanoma	Associate	8063762
Neoplasm Metastasis	Associate	28557334, 30635982, 35179814, 40604866
Neoplasms	Stimulate	14504053, 40604866
Neoplasms	Associate	15684595, 15797857, 17091770, 1733956, 23349846, 25774687, 26687816, 26914549, 30497491, 30635982, 37960806, 39238647, 8063762
Neoplastic Syndromes Hereditary	Associate	9621070
Neuroblastoma	Associate	26687816
Neurodegenerative Diseases	Associate	25617851, 32868733
Nonseminomatous germ cell tumor	Stimulate	14504053
Osteoarthritis	Associate	12681952
Osteoporosis	Associate	25123647
Ovarian Neoplasms	Associate	25418856
Pancreatic Neoplasms	Associate	35179814
Prostatic Hyperplasia	Associate	37705744
Prostatic Neoplasms	Associate	36124532
Rectal Neoplasms	Associate	33833937
Rhabdoid Tumor	Associate	20212451
Schizophrenia	Associate	32868733, 34667143
Simpson Golabi Behmel syndrome	Associate	22286531, 22848377
Small Cell Lung Carcinoma	Associate	30635982
Squamous Cell Carcinoma of Head and Neck	Associate	37960806
Testicular Diseases	Associate	39241251
Testicular Neoplasms	Associate	14504053
Thyroid Cancer Papillary	Associate	26914549
Triple Negative Breast Neoplasms	Associate	30497491

PTN (pleiotrophin)