Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	57628
Gene name Gene Name - the full gene name approved by the HGNC.	Dipeptidyl peptidase like 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DPP10
Synonyms (NCBI Gene) Gene synonyms aliases	DPL2, DPPY, DPRP-3, DPRP3
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q14.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally prese

Show/Hide all(21)

miRTarBase ID	miRNA	Experiments
MIRT944148	hsa-miR-4668-3p	CLIP-seq
MIRT944149	hsa-miR-4668-5p	CLIP-seq
MIRT944150	hsa-miR-4705	CLIP-seq
MIRT944151	hsa-miR-105	CLIP-seq
MIRT944152	hsa-miR-192	CLIP-seq
MIRT944153	hsa-miR-215	CLIP-seq
MIRT944154	hsa-miR-3146	CLIP-seq
MIRT944155	hsa-miR-3183	CLIP-seq
MIRT944156	hsa-miR-3671	CLIP-seq
MIRT944157	hsa-miR-3908	CLIP-seq
MIRT944158	hsa-miR-3942-5p	CLIP-seq
MIRT944159	hsa-miR-4272	CLIP-seq
MIRT944160	hsa-miR-4496	CLIP-seq
MIRT944161	hsa-miR-4703-5p	CLIP-seq
MIRT944162	hsa-miR-4723-3p	CLIP-seq
MIRT944163	hsa-miR-4766-3p	CLIP-seq
MIRT944164	hsa-miR-581	CLIP-seq
MIRT944165	hsa-miR-607	CLIP-seq
MIRT944166	hsa-miR-630	CLIP-seq
MIRT1979567	hsa-miR-548p	CLIP-seq
MIRT2448511	hsa-miR-539	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006508	Process	Proteolysis	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	IBA
GO:0008076	Component	Voltage-gated potassium channel complex	IPI	27198182
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008239	Function	Dipeptidyl-peptidase activity	IDA	12662155
GO:0015459	Function	Potassium channel regulator activity	IBA
GO:0015459	Function	Potassium channel regulator activity	ISS
GO:0016020	Component	Membrane	IDA	12662155
GO:0016020	Component	Membrane	IEA
GO:0044325	Function	Transmembrane transporter binding	IPI	27198182
GO:0072659	Process	Protein localization to plasma membrane	ISS
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IBA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	ISS
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IDA	15671030

MIM	HGNC	e!Ensembl
608209	20823	ENSG00000175497

Protein

UniProt ID

Q8N608

Protein name

Inactive dipeptidyl peptidase 10 (Dipeptidyl peptidase IV-related protein 3) (DPRP-3) (Dipeptidyl peptidase X) (DPP X) (Dipeptidyl peptidase-like protein 2) (DPL2)

Protein function

Promotes cell surface expression of the potassium channel KCND2 (PubMed:15454437). Modulates the activity and gating characteristics of the potassium channel KCND2 (PubMed:15454437). Has no dipeptidyl aminopeptidase activity (PubMed:12662155). {

PDB

4WJL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00930	DPPIV_N	133 → 500	Dipeptidyl peptidase IV (DPP IV) N-terminal region	Family
PF00326	Peptidase_S9	580 → 784	Prolyl oligopeptidase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Found in serum, T-cells and brain (at protein level). Expressed in brain, pancreas, spinal cord and adrenal glands. {ECO:0000269|PubMed:12662155, ECO:0000269|PubMed:14566338}.

Sequence

MNQTASVSHHIKCQPSKTIKELGSNSPPQRNWKGIAIALLVILVVCSLITMSVILLTPDE
LTNSSETRLSLEDLFRKDFVLHDPEARWINDTDVVYKSENGHVIKLNIETNATTLLLENT
TFVTFKASRHSVSPDLKYVLLAYDVKQIFHYSYTASYVIYNIHTREVWELNPPEVEDSVL
QYAAWGVQGQQLIYIFENNIYYQPDIKSSSLRLTSSGKEEIIFNGIADWLYEEELLHSHI
AHWWSPDGERLAFLMINDSLVPTMVIPRFTGALYPKGKQYPYPKAGQVNPTIKLYVVNLY
GPTHTLELMPPDSFKSREYYITMVKWVSNTKTVVRWLNRAQNISILTVCETTTGACSKKY
EMTSDTWLSQQNEEPVFSRDGSKFFMTVPVKQGGRGEFHHVAMFLIQSKSEQITVRHLTS
GNWEVIKILAYDETTQKIYFLSTESSPRGRQLYSASTEGLLNRQCISCNFMKEQCTYFDA
SFSPMNQHFLLFCEGPRVPVVSLHSTDNPAKYFILESNSMLKEAILKKKIGKPEIKILHI
DDYELPLQLSLPKDFMDRNQYALLLIMDEEPGGQLVTDKFHIDWDSVLIDMDNVIVARFD
GRGSGFQGLKILQEIHRRLGSVEVKDQITAVKFLLKLPYIDSKRLSIFGKGYGGYIASMI
LKSDEKLFKCGSVVAPITDLKLYASAFSERYLGMPSKEESTYQAASVLHNVHGLKEENIL
IIHGTADTKVHFQHSAELIKHLIKAGVNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDC
LKEEISVLPQEPEEDE

Sequence length

796

Interactions

View interactions

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Astrocytoma	Pilocytic astrocytoma	N/A	N/A	GWAS
Attention Deficit Hyperactivity Disorder	Attention deficit hyperactivity disorder	N/A	N/A	GWAS
Bipolar Disorder	Bipolar disorder	N/A	N/A	GWAS
Colorectal Cancer	Colorectal cancer	N/A	N/A	GWAS
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Glioblastoma	Glioblastoma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (27)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
AA amyloidosis	Associate	10468868
Adenoma	Associate	34477243
Alzheimer Disease	Associate	25025038, 25740212, 36982982
Asthma	Associate	19672052, 19910030, 19951440, 21103062, 22325360, 24253534, 32119686
Astrocytoma	Associate	32647207
Attention Deficit Disorder with Hyperactivity	Associate	28630479
Autism Spectrum Disorder	Associate	18252227, 24736721, 28670437, 32393163, 32807774
Autistic Disorder	Associate	23375656
Carcinogenesis	Associate	29049217
Colitis Ulcerative	Associate	33323040
Colorectal Neoplasms	Associate	24142639, 32651213
Conversion Disorder	Associate	24253534
Dementia	Associate	25740212
Diabetes Gestational	Associate	35721735
Drug Hypersensitivity	Associate	37242299
Dyskinesia Familial with Facial Myokymia	Associate	10468868
Eye Neoplasms	Associate	32393163
Glioblastoma	Associate	32647207
Heart Diseases	Associate	10468868
Ige Responsiveness Atopic	Associate	37242299
Mesothelioma Malignant	Associate	20485525
Neurodegenerative Diseases	Associate	25025038, 25740212
Oculocerebrorenal Syndrome	Associate	32393163
Pancreatic Neoplasms	Associate	25945796, 29049217
Pulmonary Disease Chronic Obstructive	Associate	24253534
Respiratory Hypersensitivity	Associate	19951440
Schizophrenia	Associate	24736721, 36982982

DPP10 (dipeptidyl peptidase like 10)