Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	57620
Gene name	Stromal interaction molecule 2
Gene symbol	STIM2
Synonyms (NCBI Gene)	-
Chromosome	4
Chromosome location	4p15.2
Summary	This gene is a member of the stromal interaction molecule (STIM) family and likely arose, along with related family member STIM1, from a common ancestral gene. The encoded protein functions to regulate calcium concentrations in the cytosol and endoplasmic

163

Show/Hide all (163)

miRTarBase ID	miRNA	Experiments	Reference
MIRT036939	hsa-miR-877-3p	CLASH	23622248
MIRT439526	hsa-miR-1185-2-3p	HITS-CLIP	24374217
MIRT439524	hsa-miR-1185-1-3p	HITS-CLIP	24374217
MIRT439526	hsa-miR-1185-2-3p	HITS-CLIP	24374217
MIRT439524	hsa-miR-1185-1-3p	HITS-CLIP	24374217
MIRT1397053	hsa-miR-181a	CLIP-seq
MIRT1397054	hsa-miR-181b	CLIP-seq
MIRT1397055	hsa-miR-181c	CLIP-seq
MIRT1397056	hsa-miR-181d	CLIP-seq
MIRT1397057	hsa-miR-4262	CLIP-seq
MIRT1397058	hsa-miR-4323	CLIP-seq
MIRT1397059	hsa-miR-4653-3p	CLIP-seq
MIRT1397060	hsa-miR-125a-5p	CLIP-seq
MIRT1397061	hsa-miR-125b	CLIP-seq
MIRT1397062	hsa-miR-1297	CLIP-seq
MIRT1397063	hsa-miR-1299	CLIP-seq
MIRT1397064	hsa-miR-130a	CLIP-seq
MIRT1397065	hsa-miR-130b	CLIP-seq
MIRT1397066	hsa-miR-145	CLIP-seq
MIRT1397067	hsa-miR-199a-3p	CLIP-seq
MIRT1397068	hsa-miR-199b-3p	CLIP-seq
MIRT1397069	hsa-miR-2113	CLIP-seq
MIRT1397070	hsa-miR-2277-5p	CLIP-seq
MIRT1397071	hsa-miR-26a	CLIP-seq
MIRT1397072	hsa-miR-26b	CLIP-seq
MIRT1397073	hsa-miR-301a	CLIP-seq
MIRT1397074	hsa-miR-301b	CLIP-seq
MIRT1397075	hsa-miR-3065-3p	CLIP-seq
MIRT1397076	hsa-miR-3065-5p	CLIP-seq
MIRT1397077	hsa-miR-3129-5p	CLIP-seq
MIRT1397078	hsa-miR-3136-5p	CLIP-seq
MIRT1397079	hsa-miR-3148	CLIP-seq
MIRT1397080	hsa-miR-3152-3p	CLIP-seq
MIRT1397081	hsa-miR-3180-5p	CLIP-seq
MIRT1397082	hsa-miR-3663-3p	CLIP-seq
MIRT1397083	hsa-miR-3666	CLIP-seq
MIRT1397084	hsa-miR-3682-5p	CLIP-seq
MIRT1397085	hsa-miR-4275	CLIP-seq
MIRT1397086	hsa-miR-4295	CLIP-seq
MIRT1397087	hsa-miR-4319	CLIP-seq
MIRT1397088	hsa-miR-4439	CLIP-seq
MIRT1397089	hsa-miR-4465	CLIP-seq
MIRT1397090	hsa-miR-4513	CLIP-seq
MIRT1397091	hsa-miR-454	CLIP-seq
MIRT1397092	hsa-miR-4671-3p	CLIP-seq
MIRT1397093	hsa-miR-4690-3p	CLIP-seq
MIRT1397094	hsa-miR-4732-3p	CLIP-seq
MIRT1397095	hsa-miR-4753-3p	CLIP-seq
MIRT1397096	hsa-miR-518a-3p	CLIP-seq
MIRT1397097	hsa-miR-518b	CLIP-seq
MIRT1397098	hsa-miR-518c	CLIP-seq
MIRT1397099	hsa-miR-518d-3p	CLIP-seq
MIRT1397100	hsa-miR-518f	CLIP-seq
MIRT1397101	hsa-miR-548c-3p	CLIP-seq
MIRT1397102	hsa-miR-570	CLIP-seq
MIRT1397103	hsa-miR-579	CLIP-seq
MIRT1397104	hsa-miR-599	CLIP-seq
MIRT1397105	hsa-miR-622	CLIP-seq
MIRT1397106	hsa-miR-670	CLIP-seq
MIRT1397107	hsa-miR-875-3p	CLIP-seq
MIRT1397108	hsa-miR-1284	CLIP-seq
MIRT1397063	hsa-miR-1299	CLIP-seq
MIRT1397064	hsa-miR-130a	CLIP-seq
MIRT1397065	hsa-miR-130b	CLIP-seq
MIRT1397066	hsa-miR-145	CLIP-seq
MIRT1397067	hsa-miR-199a-3p	CLIP-seq
MIRT1397068	hsa-miR-199b-3p	CLIP-seq
MIRT1397109	hsa-miR-2467-3p	CLIP-seq
MIRT1397073	hsa-miR-301a	CLIP-seq
MIRT1397074	hsa-miR-301b	CLIP-seq
MIRT1397077	hsa-miR-3129-5p	CLIP-seq
MIRT1397079	hsa-miR-3148	CLIP-seq
MIRT1397081	hsa-miR-3180-5p	CLIP-seq
MIRT1397110	hsa-miR-3614-5p	CLIP-seq
MIRT1397083	hsa-miR-3666	CLIP-seq
MIRT1397111	hsa-miR-3678-3p	CLIP-seq
MIRT1397085	hsa-miR-4275	CLIP-seq
MIRT1397086	hsa-miR-4295	CLIP-seq
MIRT1397091	hsa-miR-454	CLIP-seq
MIRT1397092	hsa-miR-4671-3p	CLIP-seq
MIRT1397112	hsa-miR-4738-3p	CLIP-seq
MIRT1397113	hsa-miR-4756-3p	CLIP-seq
MIRT1397114	hsa-miR-513b	CLIP-seq
MIRT1397102	hsa-miR-570	CLIP-seq
MIRT1397115	hsa-miR-582-5p	CLIP-seq
MIRT1397116	hsa-miR-618	CLIP-seq
MIRT1397105	hsa-miR-622	CLIP-seq
MIRT1397107	hsa-miR-875-3p	CLIP-seq
MIRT1557148	hsa-miR-153	CLIP-seq
MIRT1557149	hsa-miR-448	CLIP-seq
MIRT2118876	hsa-miR-129-5p	CLIP-seq
MIRT1397069	hsa-miR-2113	CLIP-seq
MIRT1397076	hsa-miR-3065-5p	CLIP-seq
MIRT1397080	hsa-miR-3152-3p	CLIP-seq
MIRT2118877	hsa-miR-4255	CLIP-seq
MIRT1397085	hsa-miR-4275	CLIP-seq
MIRT1397104	hsa-miR-599	CLIP-seq
MIRT1397063	hsa-miR-1299	CLIP-seq
MIRT2341239	hsa-miR-1305	CLIP-seq
MIRT1397064	hsa-miR-130a	CLIP-seq
MIRT1397065	hsa-miR-130b	CLIP-seq
MIRT1397066	hsa-miR-145	CLIP-seq
MIRT2341240	hsa-miR-146a	CLIP-seq
MIRT2341241	hsa-miR-146b-5p	CLIP-seq
MIRT1557148	hsa-miR-153	CLIP-seq
MIRT1397067	hsa-miR-199a-3p	CLIP-seq
MIRT1397068	hsa-miR-199b-3p	CLIP-seq
MIRT1397109	hsa-miR-2467-3p	CLIP-seq
MIRT1397073	hsa-miR-301a	CLIP-seq
MIRT1397074	hsa-miR-301b	CLIP-seq
MIRT1397076	hsa-miR-3065-5p	CLIP-seq
MIRT1397077	hsa-miR-3129-5p	CLIP-seq
MIRT1397079	hsa-miR-3148	CLIP-seq
MIRT1397081	hsa-miR-3180-5p	CLIP-seq
MIRT2341242	hsa-miR-330-3p	CLIP-seq
MIRT1397110	hsa-miR-3614-5p	CLIP-seq
MIRT1397083	hsa-miR-3666	CLIP-seq
MIRT1397111	hsa-miR-3678-3p	CLIP-seq
MIRT2341243	hsa-miR-4251	CLIP-seq
MIRT1397085	hsa-miR-4275	CLIP-seq
MIRT1397086	hsa-miR-4295	CLIP-seq
MIRT2341244	hsa-miR-4420	CLIP-seq
MIRT2341245	hsa-miR-4436b-5p	CLIP-seq
MIRT1557149	hsa-miR-448	CLIP-seq
MIRT1397091	hsa-miR-454	CLIP-seq
MIRT2341246	hsa-miR-466	CLIP-seq
MIRT1397092	hsa-miR-4671-3p	CLIP-seq
MIRT1397113	hsa-miR-4756-3p	CLIP-seq
MIRT2341247	hsa-miR-499-3p	CLIP-seq
MIRT2341248	hsa-miR-499a-3p	CLIP-seq
MIRT1397114	hsa-miR-513b	CLIP-seq
MIRT1397102	hsa-miR-570	CLIP-seq
MIRT1397103	hsa-miR-579	CLIP-seq
MIRT1397115	hsa-miR-582-5p	CLIP-seq
MIRT2341249	hsa-miR-589	CLIP-seq
MIRT1397105	hsa-miR-622	CLIP-seq
MIRT1397107	hsa-miR-875-3p	CLIP-seq
MIRT2118876	hsa-miR-129-5p	CLIP-seq
MIRT2635136	hsa-miR-188-3p	CLIP-seq
MIRT1397069	hsa-miR-2113	CLIP-seq
MIRT1397070	hsa-miR-2277-5p	CLIP-seq
MIRT1397075	hsa-miR-3065-3p	CLIP-seq
MIRT1397076	hsa-miR-3065-5p	CLIP-seq
MIRT1397080	hsa-miR-3152-3p	CLIP-seq
MIRT2635137	hsa-miR-3925-3p	CLIP-seq
MIRT2635138	hsa-miR-3941	CLIP-seq
MIRT2118877	hsa-miR-4255	CLIP-seq
MIRT2341246	hsa-miR-466	CLIP-seq
MIRT2635139	hsa-miR-4672	CLIP-seq
MIRT1397101	hsa-miR-548c-3p	CLIP-seq
MIRT1397102	hsa-miR-570	CLIP-seq
MIRT1397104	hsa-miR-599	CLIP-seq
MIRT2635140	hsa-miR-766	CLIP-seq
MIRT1397070	hsa-miR-2277-5p	CLIP-seq
MIRT1397081	hsa-miR-3180-5p	CLIP-seq
MIRT1397112	hsa-miR-4738-3p	CLIP-seq
MIRT1397114	hsa-miR-513b	CLIP-seq
MIRT1397096	hsa-miR-518a-3p	CLIP-seq
MIRT1397097	hsa-miR-518b	CLIP-seq
MIRT1397098	hsa-miR-518c	CLIP-seq
MIRT1397099	hsa-miR-518d-3p	CLIP-seq
MIRT1397100	hsa-miR-518f	CLIP-seq
MIRT1397103	hsa-miR-579	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002115	Process	Store-operated calcium entry	IBA
GO:0005246	Function	Calcium channel regulator activity	IBA
GO:0005246	Function	Calcium channel regulator activity	IEA
GO:0005246	Function	Calcium channel regulator activity	IMP	18160041
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	18166150
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	11463338, 17905723, 28514442, 33961781, 35271311
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	18160041
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	18160041
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IBA
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IMP	18160041
GO:0015279	Function	Store-operated calcium channel activity	IDA	16860747
GO:0016020	Component	Membrane	IEA
GO:0032237	Process	Activation of store-operated calcium channel activity	IDA	17905723
GO:0032237	Process	Activation of store-operated calcium channel activity	IMP	18160041
GO:0046872	Function	Metal ion binding	IEA
GO:0051928	Process	Positive regulation of calcium ion transport	IDA	17905723
GO:0051928	Process	Positive regulation of calcium ion transport	IMP	18160041
GO:0070588	Process	Calcium ion transmembrane transport	IEA

MIM	HGNC	e!Ensembl
610841	19205	ENSG00000109689

Q9P246

Protein name

Stromal interaction molecule 2

Protein function

Plays a role in mediating store-operated Ca(2+) entry (SOCE), a Ca(2+) influx following depletion of intracellular Ca(2+) stores. Functions as a highly sensitive Ca(2+) sensor in the endoplasmic reticulum which activates both store-operated and

PDB

2L5Y

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07647	SAM_2	133 → 202	SAM domain (Sterile alpha motif)	Domain
PF16533	SOAR	345 → 445	STIM1 Orai1-activating region	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues and tumor cell lines examined. {ECO:0000269|PubMed:11463338}.

Sequence

MLVLGLLVAGAADGCELVPRHLRGRRATGSAATAASSPAAAAGDSPALMTDPCMSLSPPC
FTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHIT
IEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMI
SQLKISDRSHRQKLQLKALDVVLFGPLTRPPHNWMKDFILTVSIVIGVGGCWFAYTQNKT
SKEHVAKMMKDLESLQTAEQSLMDLQERLEKAQEENRNVAVEKQNLERKMMDEINYAKEE
ACRLRELREGAECELSRRQYAEQELEQVRMALKKAEKEFELRSSWSVPDALQKWLQLTHE
VEVQYYNIKRQNAEMQLAIAKDEAEKIKKKRSTVFGTLHVAHSSSLDEVDHKILEAKKAL
SELTTCLRERLFRWQQIEKICGFQIAHNSGLPSLTSSLYSDHSWVVMPRVSIPPYPIAGG
VDDLDEDTPPIVSQFPGTMAKPPGSLARSSSLCRSRRSIVPSSPQPQRAQLAPHAPHPSH
PRHPHHPQHTPHSLPSPDPDILSVSSCPALYRNEEEEEAIYFSAEKQWEVPDTASECDSL
NSSIGRKQSPPLSLEIYQTLSPRKISRDEVSLEDSSRGDSPVTVDVSWGSPDCVGLTETK
SMIFSPASKVYNGILEKSCSMNQLSSGIPVPKPRHTSCSSAGNDSKPVQEAPSVARISSI
PHDLCHNGEKSKKPSKIKSLFKKKSK

Sequence length

746

Interactions

View interactions

	KEGG
	Calcium signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BRONCHIAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HIRSCHSPRUNG DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TIETZE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	20395295	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	25143380	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	25143380	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cysts	Associate	33943042	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Associate	30543678	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Associate	32315120	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	17002787	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Stimulate	29351410	★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Associate	32315120	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	17002787, 36057880	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	25143380	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroacanthocytosis	Associate	30453283	★★★★★ ★☆☆☆☆ Found in Text Mining only
Phenylketonurias	Associate	29358461	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Stimulate	35669690	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Associate	29358461	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wolf Hirschhorn Syndrome	Stimulate	36980907	★★★★★ ★☆☆☆☆ Found in Text Mining only

STIM2 (stromal interaction molecule 2)