Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	57616
Gene name	Teashirt zinc finger homeobox 3
Gene symbol	TSHZ3
Synonyms (NCBI Gene)	TSH3ZNF537
Chromosome	19
Chromosome location	19q12
Summary	This gene encodes a zinc-finger transcription factor that regulates smooth muscle cell differentiation in the developing urinary tract. Consistent with this role, mice in which this gene has been inactivated exhibit abnormal gene expression in urinary tra

Show/Hide all (68)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004604	hsa-miR-155-5p	Luciferase reporter assay	19177201
MIRT004604	hsa-miR-155-5p	Review	20026422
MIRT030966	hsa-miR-21-5p	Microarray	18591254
MIRT050311	hsa-miR-25-3p	CLASH	23622248
MIRT046112	hsa-miR-30b-5p	CLASH	23622248
MIRT1458846	hsa-miR-1183	CLIP-seq
MIRT1458847	hsa-miR-1305	CLIP-seq
MIRT1458848	hsa-miR-1910	CLIP-seq
MIRT1458849	hsa-miR-3121-3p	CLIP-seq
MIRT1458850	hsa-miR-340	CLIP-seq
MIRT1458851	hsa-miR-3671	CLIP-seq
MIRT1458852	hsa-miR-3686	CLIP-seq
MIRT1458853	hsa-miR-3924	CLIP-seq
MIRT1458854	hsa-miR-3973	CLIP-seq
MIRT1458855	hsa-miR-409-3p	CLIP-seq
MIRT1458856	hsa-miR-4257	CLIP-seq
MIRT1458857	hsa-miR-4418	CLIP-seq
MIRT1458858	hsa-miR-4652-3p	CLIP-seq
MIRT1458859	hsa-miR-4721	CLIP-seq
MIRT1458860	hsa-miR-4742-3p	CLIP-seq
MIRT1458861	hsa-miR-4744	CLIP-seq
MIRT1458862	hsa-miR-487a	CLIP-seq
MIRT1458863	hsa-miR-488	CLIP-seq
MIRT1458864	hsa-miR-495	CLIP-seq
MIRT1458865	hsa-miR-509-3-5p	CLIP-seq
MIRT1458866	hsa-miR-509-5p	CLIP-seq
MIRT1458867	hsa-miR-510	CLIP-seq
MIRT1458868	hsa-miR-512-5p	CLIP-seq
MIRT1458869	hsa-miR-548k	CLIP-seq
MIRT1458870	hsa-miR-548p	CLIP-seq
MIRT1458871	hsa-miR-568	CLIP-seq
MIRT1458872	hsa-miR-607	CLIP-seq
MIRT2137707	hsa-miR-330-3p	CLIP-seq
MIRT2137708	hsa-miR-4446-5p	CLIP-seq
MIRT2137709	hsa-miR-4755-5p	CLIP-seq
MIRT2137710	hsa-miR-642a	CLIP-seq
MIRT2358543	hsa-miR-1279	CLIP-seq
MIRT2358544	hsa-miR-3065-5p	CLIP-seq
MIRT2358545	hsa-miR-338-5p	CLIP-seq
MIRT2358546	hsa-miR-3688-3p	CLIP-seq
MIRT2358547	hsa-miR-3907	CLIP-seq
MIRT2358548	hsa-miR-3910	CLIP-seq
MIRT2358549	hsa-miR-3977	CLIP-seq
MIRT2358550	hsa-miR-4289	CLIP-seq
MIRT2358551	hsa-miR-505	CLIP-seq
MIRT2358552	hsa-miR-548an	CLIP-seq
MIRT2358553	hsa-miR-802	CLIP-seq
MIRT2396416	hsa-miR-2116	CLIP-seq
MIRT2396417	hsa-miR-4677-5p	CLIP-seq
MIRT2358545	hsa-miR-338-5p	CLIP-seq
MIRT2434369	hsa-miR-4307	CLIP-seq
MIRT2651835	hsa-miR-1272	CLIP-seq
MIRT2651836	hsa-miR-1322	CLIP-seq
MIRT2358545	hsa-miR-338-5p	CLIP-seq
MIRT1458853	hsa-miR-3924	CLIP-seq
MIRT2651837	hsa-miR-4263	CLIP-seq
MIRT2651838	hsa-miR-4517	CLIP-seq
MIRT1458871	hsa-miR-568	CLIP-seq
MIRT2651839	hsa-miR-576-5p	CLIP-seq
MIRT2651835	hsa-miR-1272	CLIP-seq
MIRT2651836	hsa-miR-1322	CLIP-seq
MIRT2358545	hsa-miR-338-5p	CLIP-seq
MIRT1458853	hsa-miR-3924	CLIP-seq
MIRT2651837	hsa-miR-4263	CLIP-seq
MIRT2651838	hsa-miR-4517	CLIP-seq
MIRT2694308	hsa-miR-548c-3p	CLIP-seq
MIRT1458871	hsa-miR-568	CLIP-seq
MIRT2651839	hsa-miR-576-5p	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0002087	Process	Regulation of respiratory gaseous exchange by nervous system process	IBA
GO:0002087	Process	Regulation of respiratory gaseous exchange by nervous system process	ISS
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	19343227
GO:0005515	Function	Protein binding	IPI	19343227, 25416956, 31515488, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19343227
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0030426	Component	Growth cone	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	19343227
GO:0046872	Function	Metal ion binding	IEA
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	ISS
GO:0060291	Process	Long-term synaptic potentiation	ISS

MIM	HGNC	e!Ensembl
614119	30700	ENSG00000121297

Q63HK5

Protein name

Teashirt homolog 3 (Zinc finger protein 537)

Protein function

Transcriptional regulator involved in developmental processes. Functions in association with APBB1, SET and HDAC factors as a transcriptional repressor, that inhibits the expression of CASP4. TSHZ3-mediated transcription repression involves the

PDB

2DMI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13912	zf-C2H2_6	276 → 302		Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain; strongly reduced in post-mortem elderly subjects with Alzheimer disease (PubMed:18776146, PubMed:19343227). Expressed in the fetal neocortex (PubMed:27668656). {ECO:0000269|PubMed:18776146, ECO:0000269|PubMed:193432

Sequence

MPRRKQQAPRRAAAYVSEELKAAALVDEGLDPEEHTADGEPSAKYMCPEKELARACPSYQ
NSPAAEFSCHEMDSESHISETSDRMADFESGSIKNEEETKEVTVPLEDTTVSDSLEQMKA
VYNNFLSNSYWSNLNLNLHQPSSEKNNGSSSSSSSSSSSCGSGSFDWHQSAMAKTLQQVS
QSRMLPEPSLFSTVQLYRQSSKLYGSIFTGASKFRCKDCSAAYDTLVELTVHMNETGHYR
DDNHETDNNNPKRWSKPRKRSLLEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHY
QKVPLKEPVTPVAAKIIPATRKKASLELELPSSPDSTGGTPKATISDTNDALQKNSNPYI
TPNNRYGHQNGASYAWHFEARKSQILKCMECGSSHDTLQELTAHMMVTGHFIKVTNSAMK
KGKPIVETPVTPTITTLLDEKVQSVPLAATTFTSPSNTPASISPKLNVEVKKEVDKEKAV
TDEKPKQKDKPGEEEEKCDISSKYHYLTENDLEESPKGGLDILKSLENTVTSAINKAQNG
TPSWGGYPSIHAAYQLPNMMKLSLGSSGKSTPLKPMFGNSEIVSPTKNQTLVSPPSSQTS
PMPKTNFHAMEELVKKVTEKVAKVEEKMKEPDGKLSPPKRATPSPCSSEVGEPIKMEASS
DGGFRSQENSPSPPRDGCKDGSPLAEPVENGKELVKPLASSLSGSTAIITDHPPEQPFVN
PLSALQSVMNIHLGKAAKPSLPALDPMSMLFKMSNSLAEKAAVATPPPLQSKKADHLDRY
FYHVNNDQPIDLTKGKSDKGCSLGSVLLSPTSTAPATSSSTVTTAKTSAVVSFMSNSPLR
ENALSDISDMLKNLTESHTSKSSTPSSISEKSDIDGATLEEAEESTPAQKRKGRQSNWNP
QHLLILQAQFAASLRQTSEGKYIMSDLSPQERMHISRFTGLSMTTISHWLANVKYQLRRT
GGTKFLKNLDTGHPVFFCNDCASQIRTPSTYISHLESHLGFRLRDLSKLSTEQINSQIAQ
TKSPSEKMVTSSPEEDLGTSYQCKLCNRTFASKHAVKLHLSKTHGKSPEDHLLYVSELEK
Q

Sequence length

1081

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Congenital anomaly of kidney and urinary tract	Uncertain significance	rs111618794	RCV004723541
Prostate cancer	Uncertain significance	rs193921027	RCV000149275
TSHZ3-related disorder	Benign; Uncertain significance; Likely benign	rs28609894, rs3745784, rs371933427, rs202051606, rs147790864, rs143453460, rs146715477, rs143383836, rs1225573150, rs139342269, rs376822944, rs540753819, rs762389494, rs188105336, rs139947200 View all (13 more)	RCV003980839 RCV003984029 RCV003900922 RCV003397638 RCV003946574 RCV003919150 RCV003946635 RCV003909399 RCV003906834 RCV003906928 RCV003942121 RCV003959499 RCV003963895 RCV003963905 RCV003917237 RCV003941715 RCV003949718 RCV003959256 RCV003914530 RCV003951359 RCV003951366 RCV003959085 RCV003907379 RCV003944288 RCV003954611 RCV003969020 RCV003906022 RCV003920831

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	21423795
Carcinoma Non Small Cell Lung	Associate	28296343
Esophageal Neoplasms	Associate	37445849
Glioma	Associate	28780604
Hodgkin Disease	Associate	19177201
Mental Disorders	Associate	30545854
Neoplasms	Inhibit	21423795
Pediatric acute onset neuropsychiatric syndrome	Associate	30545854

TSHZ3 (teashirt zinc finger homeobox 3)