Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	57576
Gene name Gene Name - the full gene name approved by the HGNC.	Kinesin family member 17
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KIF17
Synonyms (NCBI Gene) Gene synonyms aliases	KIF17B, KIF3X, KLP-2, OSM-3
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.12

Show/Hide all(12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016958	hsa-miR-335-5p	Microarray	18185580
MIRT1093454	hsa-miR-148a	CLIP-seq
MIRT1093455	hsa-miR-148b	CLIP-seq
MIRT1093456	hsa-miR-152	CLIP-seq
MIRT1093457	hsa-miR-34a	CLIP-seq
MIRT1093458	hsa-miR-34c-5p	CLIP-seq
MIRT1093459	hsa-miR-449a	CLIP-seq
MIRT1093460	hsa-miR-449b	CLIP-seq
MIRT1093461	hsa-miR-4651	CLIP-seq
MIRT1093462	hsa-miR-541	CLIP-seq
MIRT1093463	hsa-miR-608	CLIP-seq
MIRT1093464	hsa-miR-654-5p	CLIP-seq

Show/Hide all(40)

GO ID	Ontology	Definition	Evidence
GO:0000166	Function	Nucleotide binding	IEA
GO:0001750	Component	Photoreceptor outer segment	IEA
GO:0001917	Component	Photoreceptor inner segment	IEA
GO:0003777	Function	Microtubule motor activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IBA
GO:0005871	Component	Kinesin complex	IEA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0005929	Component	Cilium	IBA
GO:0005929	Component	Cilium	IEA
GO:0005929	Component	Cilium	ISS
GO:0005929	Component	Cilium	TAS
GO:0005930	Component	Axoneme	IEA
GO:0007017	Process	Microtubule-based process	IEA
GO:0007018	Process	Microtubule-based movement	IEA
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0008574	Function	Plus-end-directed microtubule motor activity	IBA
GO:0015031	Process	Protein transport	IEA
GO:0015630	Component	Microtubule cytoskeleton	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0030030	Process	Cell projection organization	IBA
GO:0030425	Component	Dendrite	IEA
GO:0031503	Process	Protein-containing complex localization	IEA
GO:0032391	Component	Photoreceptor connecting cilium	IEA
GO:0032839	Component	Dendrite cytoplasm	IEA
GO:0036064	Component	Ciliary basal body	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0098794	Component	Postsynapse	IEA
GO:0098971	Process	Anterograde dendritic transport of neurotransmitter receptor complex	IBA
GO:0098971	Process	Anterograde dendritic transport of neurotransmitter receptor complex	IEA
GO:1990075	Component	Periciliary membrane compartment	IEA

MIM	HGNC	e!Ensembl
605037	19167	ENSG00000117245

Protein

UniProt ID

Q9P2E2

Protein name

Kinesin-like protein KIF17 (KIF3-related motor protein)

Protein function

Dendrite-specific motor protein which, in association with the Apba1-containing complex (LIN-10-LIN-2-LIN-7 complex), transports vesicles containing N-methyl-D-aspartate (NMDA) receptor subunit NR2B along microtubules. {ECO:0000250|UniProtKB:Q99

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00225	Kinesin	11 → 335	Kinesin motor domain	Domain

Sequence

MASEAVKVVVRCRPMNQRERELRCQPVVTVDCARAQCCIQNPGAADEPPKQFTFDGAYHV
DHVTEQIYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGLPDPPSQRGIIPRAFEH
VFESVQCAENTKFLVRASYLEIYNEDVRDLLGADTKQKLELKEHPEKGVYVKGLSMHTVH
SVAQCEHIMETGWKNRSVGYTLMNKDSSRSHSIFTISIEMSAVDERGKDHLRAGKLNLVD
LAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGRCKHVPYRDSKLTRLLQDSL
GGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIRNKPRINEDPKDALLREYQEEIKKL
KAILTQQMSPSSLSALLSRQVPPDPVQVEEKLLPQPVIQHDVEAEKQLIREEYEERLARL
KADYKAEQESRARLEEDITAMRNSYDVRLSTLEENLRKETEAVLQVGVLYKAEVMSRAEF
ASSAEYPPAFQYETVVKPKVFSTTDTLPSDDVSKTQVSSRFAELPKVEPSKSEISLGSSE
SSSLEETSVSEAFPGPEEPSNVEVSMPTEESRSRYFLDECLGQEAAGHLLGEQNYLPQEE
PQEVPLQGLLGLQDPFAEVEAKLARLSSTVARTDAPQADVPKVPVQVPAPTDLLEPSDAR
PEAEAADDFPPRPEVDLASEVALEVVRTAEPGVWLEAQAPVALVAQPEPLPATAGVKRES
VGMEVAVLTDDPLPVVDQQQVLARLQLLEQQVVGGEQAKNKDLKEKHKRRKRYADERRKQ
LVAALQNSDEDSGDWVLLNVYDSIQEEVRAKSKLLEKMQRKLRAAEVEIKDLQSEFQLEK
IDYLATIRRQERDSMLLQQLLEQVQPLIRRDCNYSNLEKILRESCWDEDNGFWKIPHPVI
TKTSLPVAVSTGPQNKPARKTSAADNGEPNMEDDRYRLMLSRSNSENIASNYFRSKRASQ
ILSTDARKSLTHHNSPPGLSCPLSNNSAIPPTQAPEMPQPRPFRLESLDIPFTKAKRKKS
KSNFGSEPL

Sequence length

1029

Interactions

View interactions

	KEGG		Reactome
	Motor proteins		Intraflagellar transport

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Eosinophilia	Eosinophilic esophagitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Anophthalmia with pulmonary hypoplasia	Associate	33922911
Breast Neoplasms	Associate	39218304
Coloboma	Associate	33922911
Microphthalmos	Associate	33922911

KIF17 (kinesin family member 17)