Gene Gene information from NCBI Gene database.
Entrez ID 57570
Gene name TRNA methyltransferase 5
Gene symbol TRMT5
Synonyms (NCBI Gene)
COXPD26KIAA1393PNSEDTRM5
Chromosome 14
Chromosome location 14q23.1
Summary tRNAs contain as many as 13 or 14 nucleotides that are modified posttranscriptionally by enzymes that are highly specific for particular nucleotides in the tRNA structure. TRMT5 methylates the N1 position of guanosine-37 (G37) in selected tRNAs using S-ad
SNPs SNP information provided by dbSNP.
2
SNP ID Visualize variation Clinical significance Consequence
rs746738473 C>A,T Pathogenic Coding sequence variant, missense variant
rs1057517685 T>C Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
477
miRTarBase ID miRNA Experiments Reference
MIRT046645 hsa-miR-222-3p CLASH 23622248
MIRT711674 hsa-miR-4686 HITS-CLIP 19536157
MIRT711673 hsa-miR-4720-5p HITS-CLIP 19536157
MIRT711672 hsa-miR-4799-3p HITS-CLIP 19536157
MIRT711671 hsa-miR-5588-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0002939 Process TRNA N1-guanine methylation IBA
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion HTP 34800366
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611023 23141 ENSG00000126814
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q32P41
Protein name tRNA (guanine(37)-N(1))-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) (tRNA methyltransferase 5 homolog)
Protein function Involved in mitochondrial tRNA methylation (PubMed:26189817). Specifically methylates the N1 position of guanosine-37 in various tRNAs. Methylation is not dependent on the nature of the nucleoside 5' of the target nucleoside. This is the first s
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02475 Met_10 198 419 Met-10+ like-protein Family
Sequence
MVLWILWRPFGFSGRFLKLESHSITESKSLIPVAWTSLTQMLLEAPGIFLLGQRKRFSTM
PETETHERETELFSPPSDVRGMTKLDRTAFKKTVNIPVLKVRKEIVSKLMRSLKRAALQR
PGIRRVIEDPEDKESRLIMLDPYKIFTHDSFEKAELSVLEQLNVSPQISKYNLELTYEHF
KSEEILRAVLPEGQDVTSGFSRIGHIAHLNLRDHQLSFKHLIGQVMIDKNPGITSAVNKI
NNIDNMYRNFQMEVLSGEQNMMTKVRENNYTYEFDFSKVYWNPRLSTEHSRITELLKPGD
VLFDVFAGVGPFAIPVAKKNCTVFANDLNPESHKWLLYNCKLNKVDQKVKVFNLDGKDFL
QGPVKEELMQLLGLSKERKPSVHVVMNLPAKAIEFLSAFKWLLDGQPCSSEFLPIVHCY
S
FSKDANPAEDVRQRAGAVLGISLEACSSVHLVRNVAPNKEMLCITFQIPASVLYKNQTRN
PENHEDPPLKRQRTAEAFSDEKTQIVSNT
Sequence length 509
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
67
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Combined oxidative phosphorylation defect type 26 Likely pathogenic; Pathogenic rs1443616611, rs1057517685 RCV002510311
RCV000412548
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign; Likely benign rs35851133, rs144025340 RCV005928046
RCV005910185
Clear cell carcinoma of kidney Benign rs35851133 RCV005928047
Colon adenocarcinoma Benign; Likely benign rs144025340 RCV005910184
Familial cancer of breast Likely benign; Benign rs752158788, rs144025340 RCV005928590
RCV005910183
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acidosis Lactic Associate 26189817
Carcinogenesis Associate 36632750
Carcinoma Hepatocellular Associate 36632750
Cardiomyopathy Hypertrophic Associate 26189817
Cerebral Palsy Associate 35109800
Deafness Associate 33398350
Mitochondrial Diseases Associate 26189817
Neoplasm Metastasis Stimulate 36632750
Respiratory Insufficiency Associate 29222331, 33398350