Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57560
Gene name Gene Name - the full gene name approved by the HGNC.
Intraflagellar transport 80
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IFT80
Synonyms (NCBI Gene) Gene synonyms aliases
ATD2, CFAP167, FAP167, SRTD2, WDR56
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q25.33
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is part of the intraflagellar transport complex B and is necessary for the function of motile and sensory cilia. Defects in this gene are a cause of asphyxiating thoracic dystrophy 2 (ATD2). Three transcript variants encod
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019786 hsa-miR-375 Microarray 20215506
MIRT1061093 hsa-let-7a CLIP-seq
MIRT1061094 hsa-let-7b CLIP-seq
MIRT1061095 hsa-let-7c CLIP-seq
MIRT1061096 hsa-let-7d CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001501 Process Skeletal system development IEA
GO:0001503 Process Ossification IEA
GO:0001649 Process Osteoblast differentiation IEA
GO:0001958 Process Endochondral ossification IEA
GO:0002062 Process Chondrocyte differentiation IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611177 29262 ENSG00000068885
Protein
UniProt ID Q9P2H3
Protein name Intraflagellar transport protein 80 homolog (WD repeat-containing protein 56)
Protein function Component of the intraflagellar transport (IFT) complex B, which is essential for the development and maintenance of motile and sensory cilia.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Isoform IFT80-L is widely expressed. {ECO:0000269|PubMed:18601909}.
Sequence
MRLKISLLKEPKHQELVSCVGWTTAEELYSCSDDHQIVKWNLLTSETTQIVKLPDDIYPI
DFHWFPKSLGVKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHCGAVLAGRWNYEGTA
LVTVGEDGQIKIWSKTGMLRSTLAQQGTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAK
VLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRPLYNSQPHEHPITSVAWAPD
GELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSIDGTQIAGACGNGHVVFAHVVE
QHWEWKNFQVTLTKRRAMQVRNVLNDAVDLLEFRDRVIKASLNYAHLVVSTSLQCYVFST
KNWNTPIIFDLKEGTVSLILQAERHFLLVDGSSIYLYSYEGRFISSPKFPGMRTDILNAQ
TVSLSNDTIAIRDKADEKIIFLFEASTGKPLGDGKFLSHKNEILEIALDQKGLTNDRKIA
FIDKNRDLCITSVKRFGKEEQIIKLGTMVHTLAWNDTCNILCGLQDTRFIVWYYPNTVYV
DRDILPKTLYERDASEFSKNPHIVSFVGNQVTIRRADGSLVHISITPYPAILHEYVSSSK
WEDAVRLCRFVKEQTMWACLAAMAVANRDMTTAEIAYAAIGEIDKVQYINSIKNLPSKES
KMAHILLFSGNIQEAEIVLLQAGLVYQAIQININLYNWERALELAVKYKTHVDTVLAYRQ
KFLETFGKQETNKRYLHYAEGLQIDWEKIKAKIEMEITKEREQSSSSQSSKSIGLKP
Sequence length 777
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Intraflagellar transport
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Asphyxiating Thoracic Dystrophy asphyxiating thoracic dystrophy 2 rs431905497, rs137853115, rs138004478 N/A
Jeune Thoracic Dystrophy jeune thoracic dystrophy rs201858128, rs773858865, rs1553753582, rs372576954 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Connective Tissue Disease Connective tissue disorder N/A N/A ClinVar
Diabetes Type 2 diabetes N/A N/A GWAS
Jeune Syndrome Jeune syndrome N/A N/A GenCC
Short Rib-Polydactyly Syndrome short rib-polydactyly syndrome, Verma-Naumoff type N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Glioma Associate 36377597
Jeune syndrome Associate 30453504, 31935347
Ovarian Neoplasms Associate 31746426
Short rib polydactyly syndrome Verma Naumoff type Associate 24183449, 30453504
Squamous Cell Carcinoma of Head and Neck Associate 35403343
Stomach Neoplasms Associate 30453504