Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	57558
Gene name	Ubiquitin specific peptidase 35
Gene symbol	USP35
Synonyms (NCBI Gene)	-
Chromosome	11
Chromosome location	11q14.1
Summary	This gene encodes a member of the peptidase C19 family of ubiquitin-specific proteases. These deubiquitinating enzymes (DUBs) catalyze the removal of ubiquitin proteins from other proteins. The encoded protein associates with polarized mitochondria and ha

Show/Hide all (68)

miRTarBase ID	miRNA	Experiments	Reference
MIRT439323	hsa-miR-127-3p	HITS-CLIP	24374217
MIRT439323	hsa-miR-127-3p	HITS-CLIP	24374217
MIRT736837	hsa-miR-140-3p	Luciferase reporter assayImmunoprecipitaion (IP)Immunohistochemistry (IHC)ImmunofluorescenceqRT-PCR	34131114
MIRT736838	hsa-miR-26a-5p	Luciferase reporter assayImmunoprecipitaion (IP)Immunohistochemistry (IHC)ImmunofluorescenceqRT-PCR	34131114
MIRT1479260	hsa-miR-1224-5p	CLIP-seq
MIRT1479261	hsa-miR-149	CLIP-seq
MIRT1479262	hsa-miR-18a	CLIP-seq
MIRT1479263	hsa-miR-18b	CLIP-seq
MIRT1479264	hsa-miR-3123	CLIP-seq
MIRT1479265	hsa-miR-3160-3p	CLIP-seq
MIRT1479266	hsa-miR-3179	CLIP-seq
MIRT1479267	hsa-miR-3200-5p	CLIP-seq
MIRT1479268	hsa-miR-3202	CLIP-seq
MIRT1479269	hsa-miR-3682-5p	CLIP-seq
MIRT1479270	hsa-miR-3690	CLIP-seq
MIRT1479271	hsa-miR-3936	CLIP-seq
MIRT1479272	hsa-miR-4251	CLIP-seq
MIRT1479273	hsa-miR-4254	CLIP-seq
MIRT1479274	hsa-miR-4329	CLIP-seq
MIRT1479275	hsa-miR-4475	CLIP-seq
MIRT1479276	hsa-miR-4487	CLIP-seq
MIRT1479277	hsa-miR-4659a-5p	CLIP-seq
MIRT1479278	hsa-miR-4659b-5p	CLIP-seq
MIRT1479279	hsa-miR-4735-3p	CLIP-seq
MIRT1479280	hsa-miR-4747-5p	CLIP-seq
MIRT1479281	hsa-miR-4751	CLIP-seq
MIRT1479282	hsa-miR-4759	CLIP-seq
MIRT1479283	hsa-miR-488	CLIP-seq
MIRT1479284	hsa-miR-550b	CLIP-seq
MIRT1479285	hsa-miR-556-5p	CLIP-seq
MIRT1479286	hsa-miR-558	CLIP-seq
MIRT1479287	hsa-miR-587	CLIP-seq
MIRT1479288	hsa-miR-619	CLIP-seq
MIRT2144302	hsa-miR-205	CLIP-seq
MIRT2144303	hsa-miR-216b	CLIP-seq
MIRT2144304	hsa-miR-3150a-3p	CLIP-seq
MIRT2144305	hsa-miR-3173-3p	CLIP-seq
MIRT2144306	hsa-miR-3175	CLIP-seq
MIRT2144307	hsa-miR-3177-5p	CLIP-seq
MIRT2144308	hsa-miR-3612	CLIP-seq
MIRT2144309	hsa-miR-3667-5p	CLIP-seq
MIRT2144310	hsa-miR-3943	CLIP-seq
MIRT2144311	hsa-miR-4323	CLIP-seq
MIRT2144312	hsa-miR-4533	CLIP-seq
MIRT2144313	hsa-miR-4641	CLIP-seq
MIRT2144314	hsa-miR-4716-3p	CLIP-seq
MIRT2144315	hsa-miR-4723-5p	CLIP-seq
MIRT1479280	hsa-miR-4747-5p	CLIP-seq
MIRT2144316	hsa-miR-4779	CLIP-seq
MIRT2144317	hsa-miR-596	CLIP-seq
MIRT2144318	hsa-miR-650	CLIP-seq
MIRT2144319	hsa-miR-939	CLIP-seq
MIRT2364470	hsa-miR-125a-5p	CLIP-seq
MIRT2364471	hsa-miR-125b	CLIP-seq
MIRT2364472	hsa-miR-1266	CLIP-seq
MIRT2364473	hsa-miR-1291	CLIP-seq
MIRT2364474	hsa-miR-1827	CLIP-seq
MIRT2364475	hsa-miR-1972	CLIP-seq
MIRT2364476	hsa-miR-300	CLIP-seq
MIRT2364477	hsa-miR-3664-3p	CLIP-seq
MIRT2364478	hsa-miR-381	CLIP-seq
MIRT2144310	hsa-miR-3943	CLIP-seq
MIRT2364479	hsa-miR-4319	CLIP-seq
MIRT2144311	hsa-miR-4323	CLIP-seq
MIRT2364480	hsa-miR-4518	CLIP-seq
MIRT2364481	hsa-miR-4649-3p	CLIP-seq
MIRT2364482	hsa-miR-4650-5p	CLIP-seq
MIRT2364483	hsa-miR-544b	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004843	Function	Cysteine-type deubiquitinase activity	IBA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	14715245
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031647	Process	Regulation of protein stability	IBA

MIM	HGNC	e!Ensembl
620959	20061	ENSG00000118369

Q9P2H5

Protein name

Ubiquitin carboxyl-terminal hydrolase 35 (EC 3.4.19.12) (Deubiquitinating enzyme 35) (Ubiquitin thioesterase 35) (Ubiquitin-specific-processing protease 35)

Protein function

Deubiquitinase that plays a role in different processes including cell cycle regulation, mitophagy or endoplasmic reticulum stress (PubMed:26348204, PubMed:29449677, PubMed:37004621). Inhibits TNFalpha-induced NF-kappa-B activation through stabi

PDB

5TXK , 7Q44

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00443	UCH	441 → 923	Ubiquitin carboxyl-terminal hydrolase	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in testis, pancreas and skeletal muscle. {ECO:0000269|PubMed:14715245}.

Sequence

MDKILEAVVTSSYPVSVKQGLVRRVLEAARQPLEREQCLALLALGARLYVGGAEELPRRV
GCQLLHVAGRHHPDVFAEFFSARRVLRLLQGGAGPPGPRALACVQLGLQLLPEGPAADEV
FALLRREVLRTVCERPGPAACAQVARLLARHPRCVPDGPHRLLFCQQLVRCLGRFRCPAE
GEEGAVEFLEQAQQVSGLLAQLWRAQPAAILPCLKELFAVISCAEEEPPSSALASVVQHL
PLELMDGVVRNLSNDDSVTDSQMLTAISRMIDWVSWPLGKNIDKWIIALLKGLAAVKKFS
ILIEVSLTKIEKVFSKLLYPIVRGAALSVLKYMLLTFQHSHEAFHLLLPHIPPMVASLVK
EDSNSGTSCLEQLAELVHCMVFRFPGFPDLYEPVMEAIKDLHVPNEDRIKQLLGQDAWTS
QKSELAGFYPRLMAKSDTGKIGLINLGNTCYVNSILQALFMASDFRHCVLRLTENNSQPL
MTKLQWLFGFLEHSQRPAISPENFLSASWTPWFSPGTQQDCSEYLKYLLDRLHEEEKTGT
RICQKLKQSSSPSPPEEPPAPSSTSVEKMFGGKIVTRICCLCCLNVSSREEAFTDLSLAF
PPPERCRRRRLGSVMRPTEDITARELPPPTSAQGPGRVGPRRQRKHCITEDTPPTSLYIE
GLDSKEAGGQSSQEERIEREEEGKEERTEKEEVGEEEESTRGEGEREKEEEVEEEEEKVE
KETEKEAEQEKEEDSLGAGTHPDAAIPSGERTCGSEGSRSVLDLVNYFLSPEKLTAENRY
YCESCASLQDAEKVVELSQGPCYLILTLLRFSFDLRTMRRRKILDDVSIPLLLRLPLAGG
RGQAYDLCSVVVHSGVSSESGHYYCYAREGAARPAASLGTADRPEPENQWYLFNDTRVSF
SSFESVSNVTSFFPKDTAYVLFYRQRPREGPEAELGSSRVRTEPTLHKDLMEAISKDNIL
YLQEQEKEARSRAAYISALPTSPHWGRGFDEDKDEDEGSPGGCNPAGGNGGDFHRLVF

Sequence length

1018

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	34618999	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	25915564	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cakut	Associate	37499630	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	37594129	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	34618999, 35022505	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	34618999, 35022505	★★★★★ ★☆☆☆☆ Found in Text Mining only

USP35 (ubiquitin specific peptidase 35)