Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	5754
Gene name	Protein tyrosine kinase 7 (inactive)
Gene symbol	PTK7
Synonyms (NCBI Gene)	CCK-4CCK4
Chromosome	6
Chromosome location	6p21.1
Summary	This gene encodes a member of the receptor protein tyrosine kinase family of proteins that transduce extracellular signals across the cell membrane. The encoded protein lacks detectable catalytic tyrosine kinase activity, is involved in the Wnt signaling

Show/Hide all (72)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023149	hsa-miR-124-3p	Microarray	18668037
MIRT025958	hsa-miR-7-5p	Sequencing	20371350
MIRT049679	hsa-miR-92a-3p	CLASH	23622248
MIRT043228	hsa-miR-324-5p	CLASH	23622248
MIRT041454	hsa-miR-193b-3p	CLASH	23622248
MIRT491495	hsa-miR-3141	PAR-CLIP	23592263
MIRT491494	hsa-miR-5689	PAR-CLIP	23592263
MIRT491492	hsa-miR-190a-3p	PAR-CLIP	23592263
MIRT491493	hsa-miR-6083	PAR-CLIP	23592263
MIRT439870	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439870	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT025958	hsa-miR-7-5p	PAR-CLIP	26701625
MIRT491495	hsa-miR-3141	PAR-CLIP	23592263
MIRT491494	hsa-miR-5689	PAR-CLIP	23592263
MIRT491492	hsa-miR-190a-3p	PAR-CLIP	23592263
MIRT491493	hsa-miR-6083	PAR-CLIP	23592263
MIRT1273604	hsa-miR-3151	CLIP-seq
MIRT1273605	hsa-miR-3918	CLIP-seq
MIRT1273606	hsa-miR-4447	CLIP-seq
MIRT1273607	hsa-miR-4459	CLIP-seq
MIRT1273608	hsa-miR-4472	CLIP-seq
MIRT1273609	hsa-miR-548n	CLIP-seq
MIRT1273610	hsa-miR-548t	CLIP-seq
MIRT1273611	hsa-miR-555	CLIP-seq
MIRT1273612	hsa-miR-595	CLIP-seq
MIRT1273613	hsa-miR-665	CLIP-seq
MIRT1273614	hsa-miR-2278	CLIP-seq
MIRT1273615	hsa-miR-3908	CLIP-seq
MIRT1273605	hsa-miR-3918	CLIP-seq
MIRT1273616	hsa-miR-4267	CLIP-seq
MIRT1273617	hsa-miR-4286	CLIP-seq
MIRT1273607	hsa-miR-4459	CLIP-seq
MIRT1273618	hsa-miR-4461	CLIP-seq
MIRT1273619	hsa-miR-4477a	CLIP-seq
MIRT1273620	hsa-miR-4477b	CLIP-seq
MIRT1273621	hsa-miR-503	CLIP-seq
MIRT1273622	hsa-miR-545	CLIP-seq
MIRT1273623	hsa-miR-548ac	CLIP-seq
MIRT1273624	hsa-miR-548ae	CLIP-seq
MIRT1273625	hsa-miR-548aj	CLIP-seq
MIRT1273626	hsa-miR-548am	CLIP-seq
MIRT1273627	hsa-miR-548d-3p	CLIP-seq
MIRT1273628	hsa-miR-548x	CLIP-seq
MIRT1273629	hsa-miR-548z	CLIP-seq
MIRT1273613	hsa-miR-665	CLIP-seq
MIRT1273630	hsa-miR-767-3p	CLIP-seq
MIRT2306623	hsa-miR-1207-5p	CLIP-seq
MIRT2306624	hsa-miR-1266	CLIP-seq
MIRT2306625	hsa-miR-1909	CLIP-seq
MIRT2306626	hsa-miR-3127-5p	CLIP-seq
MIRT2306627	hsa-miR-3663-5p	CLIP-seq
MIRT1273605	hsa-miR-3918	CLIP-seq
MIRT1273616	hsa-miR-4267	CLIP-seq
MIRT2306628	hsa-miR-4305	CLIP-seq
MIRT2306629	hsa-miR-4325	CLIP-seq
MIRT2306630	hsa-miR-4436b-3p	CLIP-seq
MIRT1273607	hsa-miR-4459	CLIP-seq
MIRT2306631	hsa-miR-4518	CLIP-seq
MIRT2306632	hsa-miR-4684-3p	CLIP-seq
MIRT2306633	hsa-miR-4761-3p	CLIP-seq
MIRT2306634	hsa-miR-4763-3p	CLIP-seq
MIRT2306635	hsa-miR-500a	CLIP-seq
MIRT2306636	hsa-miR-601	CLIP-seq
MIRT1273613	hsa-miR-665	CLIP-seq
MIRT2604349	hsa-miR-1291	CLIP-seq
MIRT2604350	hsa-miR-3173-5p	CLIP-seq
MIRT2604351	hsa-miR-4753-5p	CLIP-seq
MIRT2604352	hsa-miR-4755-3p	CLIP-seq
MIRT2604349	hsa-miR-1291	CLIP-seq
MIRT2604350	hsa-miR-3173-5p	CLIP-seq
MIRT2604351	hsa-miR-4753-5p	CLIP-seq
MIRT2604352	hsa-miR-4755-3p	CLIP-seq

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001736	Process	Establishment of planar polarity	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0003281	Process	Ventricular septum development	IEA
GO:0003401	Process	Axis elongation	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	21132015, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7478540
GO:0005911	Component	Cell-cell junction	IBA
GO:0005911	Component	Cell-cell junction	IDA	20837484
GO:0005911	Component	Cell-cell junction	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IBA
GO:0007165	Process	Signal transduction	TAS	7478540
GO:0007411	Process	Axon guidance	IEA
GO:0007507	Process	Heart development	IEA
GO:0008046	Function	Axon guidance receptor activity	IBA
GO:0010976	Process	Positive regulation of neuron projection development	IMP	17910947
GO:0015026	Function	Coreceptor activity	NAS	24431302
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016477	Process	Cell migration	IMP	20837484
GO:0030036	Process	Actin cytoskeleton organization	IMP	20837484
GO:0030424	Component	Axon	IBA
GO:0042060	Process	Wound healing	IEA
GO:0043025	Component	Neuronal cell body	IBA
GO:0045198	Process	Establishment of epithelial cell apical/basal polarity	IEA
GO:0050808	Process	Synapse organization	IBA
GO:0060026	Process	Convergent extension	IEA
GO:0060484	Process	Lung-associated mesenchyme development	IEA
GO:0060828	Process	Regulation of canonical Wnt signaling pathway	IBA
GO:0060976	Process	Coronary vasculature development	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0071300	Process	Cellular response to retinoic acid	IMP	17910947
GO:0090103	Process	Cochlea morphogenesis	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IMP	21132015

MIM	HGNC	e!Ensembl
601890	9618	ENSG00000112655

Q13308

Protein name

Inactive tyrosine-protein kinase 7 (Colon carcinoma kinase 4) (CCK-4) (Protein-tyrosine kinase 7) (Pseudo tyrosine kinase receptor 7) (Tyrosine-protein kinase-like 7)

Protein function

Inactive tyrosine kinase involved in Wnt signaling pathway. Component of both the non-canonical (also known as the Wnt/planar cell polarity signaling) and the canonical Wnt signaling pathway. Functions in cell adhesion, cell migration, cell pola

PDB

6VG3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13927	Ig_3	32 → 105		Domain
PF13927	Ig_3	128 → 204		Domain
PF13927	Ig_3	226 → 304		Domain
PF07679	I-set	328 → 408	Immunoglobulin I-set domain	Domain
PF07679	I-set	412 → 498	Immunoglobulin I-set domain	Domain
PF13927	Ig_3	503 → 574		Domain
PF07679	I-set	592 → 681	Immunoglobulin I-set domain	Domain
PF07714	PK_Tyr_Ser-Thr	796 → 1061	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in lung, liver, pancreas, kidney, placenta and melanocytes. Weakly expressed in thyroid gland, ovary, brain, heart and skeletal muscle. Also expressed in erythroleukemia cells. But not expressed in colon.

Sequence

MGAARGSPARPRRLPLLSVLLLPLLGGTQTAIVFIKQPSSQDALQGRRALLRCEVEAPGP
VHVYWLLDGAPVQDTERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSANASFN
IKWIEAGPVVLKHPASEAEIQPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDGQSNHTVSS
KERNLTLRPAGPEHSGLYSCCAHSAFGQACSSQNFTLSIADESFARVVLAPQDVVVARYE
EAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATVFANGSLLLTQVRPRNAGIYR
CIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLPEPSVWWEHAG
VRLPTHGRVYQKGHELVLANIAESDAGVYTCHAANLAGQRRQDVNITVATVPSWLKKPQD
SQLEEGKPGYLDCLTQATPKPTVVWYRNQMLISEDSRFEVFKNGTLRINSVEVYDGTWYR
CMSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCSATGREKPTIKWERAD
GSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPER
TTVYQGHTALLQCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSG
RYTCIAGNSCNIKHTEAPLYVVDKPVPEESEGPGSPPPYKMIQTIGLSVGAAVAYIIAVL
GLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATN
KRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQ
LDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQ
PLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEY
YHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQ
AGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDSKP

Sequence length

1070

Interactions

View interactions

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs141307288	RCV005906750
Cervical cancer	Benign	rs141307288	RCV005906753
Cholangiocarcinoma	Benign	rs141307288	RCV005906758
Colorectal cancer	Benign	rs141307288	RCV005906755
Familial cancer of breast	Benign	rs141307288	RCV005906749
Familial pancreatic carcinoma	Benign	rs141307288	RCV005906754
Gastric cancer	Benign	rs141307288	RCV005906756
Lung cancer	Benign	rs141307288	RCV005906759
Malignant tumor of esophagus	Benign	rs141307288	RCV005906751
Nonpapillary renal cell carcinoma	Benign	rs141307288	RCV005906752
Ovarian serous cystadenocarcinoma	Benign	rs141307288	RCV005906757
PTK7-related disorder	Benign; Uncertain significance; Likely benign	rs139636574, rs34764696, rs73436429, rs2532908166, rs56350986, rs192759295, rs143042627, rs145195593, rs6905948, rs2533397293, rs61996308	RCV003929159 RCV003982494 RCV003982252 RCV003899558 RCV003933968 RCV003961760 RCV003919472 RCV003907366 RCV003981886 RCV003957224 RCV003978157
Uterine corpus endometrial carcinoma	Benign	rs141307288	RCV005906760

Show/Hide Text Mining Associations (59)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute Kidney Injury	Associate	36385130
Adenoma	Stimulate	27499181
Adrenal Cortex Neoplasms	Associate	31689287
Alopecia	Associate	40086026
Breast Neoplasms	Associate	24409301
Breast Neoplasms	Stimulate	37569547
Calcinosis Cutis	Associate	29149598
Carcinogenesis	Associate	22665490, 27499181, 29867084, 35216506, 37569547
Carcinoma Hepatocellular	Associate	31730575
Carcinoma Non Small Cell Lung	Associate	34083232, 40086026
Carcinoma Ovarian Epithelial	Associate	25550828
Carcinoma Pancreatic Ductal	Associate	33048956
Carcinoma Renal Cell	Associate	31361072
Cholangiocarcinoma	Associate	28545451
Colonic Neoplasms	Associate	22665490
Colorectal Neoplasms	Stimulate	21103379
Colorectal Neoplasms	Associate	22665490, 27499181, 29488611, 35163215
Coronary Artery Disease	Associate	38049831
Esophageal Neoplasms	Associate	28545451
Esophageal Squamous Cell Carcinoma	Stimulate	23663482
Esophageal Squamous Cell Carcinoma	Associate	27557627, 27689325, 28545451, 29867084, 35216506
Fatigue	Associate	34083232
Fibrosarcoma	Associate	24618420
Glioblastoma	Associate	37354459
Glycogen Storage Disease Type IV	Associate	31730575
Headache	Associate	34083232
Insulin Resistance	Associate	30678306
Leukemia	Associate	18363322, 19360825, 20558616
Leukemia Myeloid Acute	Associate	20558616, 22898210
Leukemia Myeloid Acute	Stimulate	21103379
Liposarcoma	Associate	21335544
Lung Neoplasms	Stimulate	21103379
Lung Neoplasms	Associate	40086026
Lymphatic Metastasis	Stimulate	24987951, 28547980
Lymphatic Metastasis	Associate	27499181, 35257502
Melanoma	Associate	29149598
Neoplasm Invasiveness	Stimulate	24987951
Neoplasm Metastasis	Associate	24409301, 25550828, 27499181, 28545451, 28547980, 35257502, 37569547
Neoplasms	Associate	19360825, 24409301, 24618420, 25550828, 27499181, 27689325, 28442586, 28547980, 29867084, 30311693, 31361072, 32633373, 34083232, 37569547, 40086026
Neoplasms	Stimulate	21103379, 22665490, 23663482, 35216506
Neoplasms Cystic Mucinous and Serous	Inhibit	25550828
Neural Tube Defects	Associate	29573971, 30689296
Neutropenia	Associate	40086026
Ovarian Neoplasms	Associate	25550828, 34083232, 35977930
Pneumonia Pneumocystis	Associate	29573971
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	22898210
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	18363322, 22898210, 30311693
Prostatic Neoplasms	Associate	24987951
Scoliosis	Associate	34828397
Spinal Dysraphism	Associate	29573971, 30689296
Squamous Cell Carcinoma of Head and Neck	Associate	28547980, 35257502
Stomach Neoplasms	Stimulate	21103379
Stomach Neoplasms	Associate	31820857
Tertiary Lymphoid Structures	Associate	24409301
Thyroid Neoplasms	Associate	32633373
Triple Negative Breast Neoplasms	Associate	24409301, 34083232
Triple Negative Breast Neoplasms	Stimulate	37569547
Typical Teratoid Rhabdoid Tumor	Stimulate	28442586
Urethritis	Associate	36124557

PTK7 (protein tyrosine kinase 7 (inactive))