Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57539
Gene name Gene Name - the full gene name approved by the HGNC.
WD repeat domain 35
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
WDR35
Synonyms (NCBI Gene) Gene synonyms aliases
CED2, CFAP118, FAP118, IFT121, IFTA1, SRTD7
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p24.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs74470618 C>T Likely-benign, conflicting-interpretations-of-pathogenicity Downstream transcript variant, missense variant, genic downstream transcript variant, non coding transcript variant, coding sequence variant
rs75602337 T>C Uncertain-significance, conflicting-interpretations-of-pathogenicity Intron variant, genic downstream transcript variant, missense variant, coding sequence variant, downstream transcript variant
rs140308808 G>A Conflicting-interpretations-of-pathogenicity, uncertain-significance Non coding transcript variant, coding sequence variant, missense variant, genic upstream transcript variant
rs142103808 G>A Conflicting-interpretations-of-pathogenicity Synonymous variant, coding sequence variant, intron variant
rs143343508 T>A Conflicting-interpretations-of-pathogenicity, uncertain-significance 5 prime UTR variant, non coding transcript variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT695767 hsa-miR-3121-3p HITS-CLIP 23313552
MIRT695766 hsa-miR-141-5p HITS-CLIP 23313552
MIRT695765 hsa-miR-4528 HITS-CLIP 23313552
MIRT695764 hsa-miR-3130-3p HITS-CLIP 23313552
MIRT695763 hsa-miR-4793-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 27932497, 29220510, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005813 Component Centrosome IEA
GO:0005813 Component Centrosome ISS
GO:0005856 Component Cytoskeleton IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613602 29250 ENSG00000118965
Protein
UniProt ID Q9P2L0
Protein name WD repeat-containing protein 35 (Intraflagellar transport protein 121 homolog)
Protein function As a component of the IFT complex A (IFT-A), a complex required for retrograde ciliary transport and entry into cilia of G protein-coupled receptors (GPCRs), it is involved in ciliogenesis and ciliary protein trafficking (PubMed:21473986, PubMed
PDB 8BBE , 8BBG , 8FGW , 8FH3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12894 ANAPC4_WD40 121 214 Anaphase-promoting complex subunit 4 WD40 domain Repeat
Sequence
MFFYLSKKISIPNNVKLQCVSWNKEQGFIACGGEDGLLKVLKLETQTDDAKLRGLAAPSN
LSMNQTLEGHSGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRS
MSWNADGQKICIVYEDGAVIVGSVDGNRIWGKDLKGIQLSHVTWSADSKVLLFGMANGEI
HIYDNQGNFMIKMKLSCLVNVTGAISIAGIHWYH
GTEGYVEPDCPCLAVCFDNGRCQIMR
HENDQNPVLIDTGMYVVGIQWNHMGSVLAVAGFQKAAMQDKDVNIVQFYTPFGEHLGTLK
VPGKEISALSWEGGGLKIALAVDSFIYFANIRPNYKWGYCSNTVVYAYTRPDRPEYCVVF
WDTKNNEKYVKYVKGLISITTCGDFCILATKADENHPQEENEMETFGATFVLVLCNSIGT
PLDPKYIDIVPLFVAMTKTHVIAASKEAFYTWQYRVAKKLTALEINQITRSRKEGRERIY
HVDDTPSGSMDGVLDYSKTIQGTRDPICAITASDKILIVGRESGTIQRYSLPNVGLIQKY
SLNCRAYQLSLNCNSSRLAIIDISGVLTFFDLDARVTDSTGQQVVGELLKLERRDVWDMK
WAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDEILKDPEHPNK
DYLINFEIRSLRDSRALIEKVGIKDASQFIEDNPHPRLWRLLAEAALQKLDLYTAEQAFV
RCKDYQGIKFVKRLGKLLSESMKQAEVVGYFGRFEEAERTYLEMDRRDLAIGLRLKLGDW
FRVLQLLKTGSGDADDSLLEQANNAIGDYFADRQKWLNAVQYYVQGRNQERLAECYYMLE
DYEGLENLAISLPENHKLLPEIAQMFVRVGMCEQAVTAFLKCSQPKAAVDTCVHLNQWNK
AVELAKNHSMKEIGSLLARYASHLLEKNKTLDAIELYRKANYFFDAAKLMFKIADEEAKK
GSKPLRVKKLYVLSALLIEQYHEQMKNAQRGKVKGKSSEATSALAGLLEEEVLSTTDRFT
DNAWRGAEAYHFFILAQRQLYEGCVDTALKTALHLKDYEDIIPPVEIYSLLALCACASRA
FGTCSKAFIKLKSLETLSSEQKQQYEDLALEIFTKHTSKDNRKPELDSLMEGGEGKLPTC
VATGSPITEYQFWMCSVCKHGVLAQEISHYSFCPLCHSPVG
Sequence length 1181
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Hedgehog 'off' state
Intraflagellar transport
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Cranioectodermal Dysplasia cranioectodermal dysplasia 2 rs397515534, rs765513105, rs267607174, rs397515334, rs200140363, rs267607175, rs199952377, rs1553313859, rs746128772, rs397515533 N/A
Jeune Thoracic Dystrophy jeune thoracic dystrophy rs1553316926, rs776631281, rs199952377 N/A
Short Rib-Polydactyly Syndrome short-rib thoracic dysplasia 7 with or without polydactyly, short rib-polydactyly syndrome rs1558342399, rs765513105, rs387907085, rs431905505, rs1553324519, rs1050086118, rs886044119 N/A
Short-Rib Thoracic Dysplasia With Or Without Polydactyly Short-rib thoracic dysplasia 6 with or without polydactyly rs765513105 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Connective Tissue Disease Connective tissue disorder N/A N/A ClinVar
Ellis-Van Creveld Syndrome ellis-van creveld syndrome N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Campomelic Dysplasia Associate 29921221
Carcinoma Ductal Associate 33369054
Ciliopathies Associate 22987818
Coronary Artery Disease Associate 33009702
Cranioectodermal Dysplasia Associate 20817137, 22987818, 29921221, 30570184, 32007091
Craniofacial Abnormalities Associate 29921221
Ellis Van Creveld Syndrome Associate 25908617, 29229899
Genetic Diseases Inborn Associate 30570184
Liver Diseases Associate 33369054
Neointima Associate 37703354