Gene Gene information from NCBI Gene database.
Entrez ID 57531
Gene name HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1
Gene symbol HACE1
Synonyms (NCBI Gene)
SPPRS
Chromosome 6
Chromosome location 6q16.3
Summary This gene encodes a HECT domain and ankyrin repeat-containing ubiquitin ligase. The encoded protein is involved in specific tagging of target proteins, leading to their subcellular localization or proteasomal degradation. The protein is a potential tumor
SNPs SNP information provided by dbSNP.
14
SNP ID Visualize variation Clinical significance Consequence
rs750371878 G>A Pathogenic Stop gained, non coding transcript variant, coding sequence variant
rs751809418 TG>- Pathogenic Non coding transcript variant, coding sequence variant, frameshift variant
rs761086584 G>A,T Pathogenic 5 prime UTR variant, stop gained, coding sequence variant, synonymous variant, non coding transcript variant
rs761703540 G>A Pathogenic Stop gained, coding sequence variant, non coding transcript variant
rs869025280 G>A Pathogenic 5 prime UTR variant, coding sequence variant, stop gained, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
175
miRTarBase ID miRNA Experiments Reference
MIRT000855 hsa-miR-15a-5p Microarray 18362358
MIRT000854 hsa-miR-16-5p Microarray 18362358
MIRT016517 hsa-miR-193b-3p Microarray 20304954
MIRT097927 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT708113 hsa-miR-511-3p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
31
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IBA
GO:0000139 Component Golgi membrane IDA 21988917
GO:0004842 Function Ubiquitin-protein transferase activity IDA 21988917, 22036506
GO:0004842 Function Ubiquitin-protein transferase activity IEA
GO:0005515 Function Protein binding IPI 22614015, 25026213, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610876 21033 ENSG00000085382
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IYU2
Protein name E3 ubiquitin-protein ligase HACE1 (EC 2.3.2.26) (HECT domain and ankyrin repeat-containing E3 ubiquitin-protein ligase 1) (HECT-type E3 ubiquitin transferase HACE1)
Protein function E3 ubiquitin-protein ligase involved in Golgi membrane fusion and regulation of small GTPases (PubMed:15254018, PubMed:21988917, PubMed:22036506, PubMed:37537642, PubMed:38332367). Acts as a regulator of Golgi membrane dynamics during the cell c
PDB 8H8X , 8HAE , 8PWL , 8Q0N
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12796 Ank_2 34 128 Ankyrin repeats (3 copies) Repeat
PF13637 Ank_4 131 184 Repeat
PF13637 Ank_4 164 217 Repeat
PF00632 HECT 602 909 HECT-domain (ubiquitin-transferase) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in multiple tissues including heart, brain and kidney. {ECO:0000269|PubMed:15254018}.
Sequence
MERAMEQLNRLTRSLRRARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYA
FGRVKRSLLHIAANCGSVECLVLLLKKGANPNYQDISGCTPLHLAARNGQKKCMSKLLEY
SADVNICN
NEGLTAIHWLAVNGRTELLHDLVQHVSDVDVEDAMGQTALHVACQNGHKTTV
QCLL
DSGADINRPNVSGATPLYFACSHGQRDTAQILL
LRGAKYLPDKNGVTPLDLCVQGG
YGETCEVLIQYHPRLFQTIIQMTQNEDLRENMLRQVLEHLSQQSESQYLKILTSLAEVAT
TNGHKLLSLSSNYDAQMKSLLRIVRMFCHVFRIGPSSPSNGIDMGYNGNKTPRSQVFKPL
ELLWHSLDEWLVLIATELMKNKRDSTEITSILLKQKGQDQDAASIPPFEPPGPGSYENLS
TGTRESKPDALAGRQEASADCQDVISMTANRLSAVIQAFYMCCSCQMPPGMTSPRFIEFV
CKHDEVLKCFVNRNPKIIFDHFHFLLECPELMSRFMHIIKAQPFKDRCEWFYEHLHSGQP
DSDMVHRPVNENDILLVHRDSIFRSSCEVVSKANCAKLKQGIAVRFHGEEGMGQGVVREW
FDILSNEIVNPDYALFTQSADGTTFQPNSNSYVNPDHLNYFRFAGQILGLALNHRQLVNI
YFTRSFYKHILGIPVNYQDVASIDPEYAKNLQWILDNDISDLGLELTFSVETDVFGAMEE
VPLKPGGGSILVTQNNKAEYVQLVTELRMTRAIQPQINAFLQGFHMFIPPSLIQLFDEYE
LELLLSGMPEIDVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSR
VPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALH
CGSYGYTMA
Sequence length 909
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
56
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Generalized hypotonia Pathogenic rs750371878 RCV001003961
Global developmental delay Pathogenic rs750371878 RCV001003961
HACE1-related disorder Likely pathogenic rs1783022008 RCV003414345
Intellectual disability Pathogenic rs750371878 RCV005625446
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Clear cell carcinoma of kidney Benign rs34365906 RCV005910133
Hepatocellular carcinoma Benign rs34365906 RCV005910132
Lung cancer Benign rs34365906 RCV005910136
Melanoma Benign rs34365906 RCV005910135
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Atrophy Associate 28584243
Carcinoma Hepatocellular Inhibit 33455098
Colonic Neoplasms Inhibit 18630515
Colorectal Neoplasms Associate 18630515, 19528486
Developmental Disabilities Associate 26424145, 36553453
GATA2 Deficiency Associate 19965620, 23142381
Glioma Associate 34815381
Immunologic Deficiency Syndromes Associate 26424145
Intellectual Disability Associate 36553453
Intestinal Diseases Associate 28584243