Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57531
Gene name Gene Name - the full gene name approved by the HGNC.
HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HACE1
Synonyms (NCBI Gene) Gene synonyms aliases
SPPRS
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q16.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a HECT domain and ankyrin repeat-containing ubiquitin ligase. The encoded protein is involved in specific tagging of target proteins, leading to their subcellular localization or proteasomal degradation. The protein is a potential tumor
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs750371878 G>A Pathogenic Stop gained, non coding transcript variant, coding sequence variant
rs751809418 TG>- Pathogenic Non coding transcript variant, coding sequence variant, frameshift variant
rs761086584 G>A,T Pathogenic 5 prime UTR variant, stop gained, coding sequence variant, synonymous variant, non coding transcript variant
rs761703540 G>A Pathogenic Stop gained, coding sequence variant, non coding transcript variant
rs869025280 G>A Pathogenic 5 prime UTR variant, coding sequence variant, stop gained, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000855 hsa-miR-15a-5p Microarray 18362358
MIRT000854 hsa-miR-16-5p Microarray 18362358
MIRT016517 hsa-miR-193b-3p Microarray 20304954
MIRT097927 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT708113 hsa-miR-511-3p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IBA
GO:0000139 Component Golgi membrane IDA 21988917
GO:0004842 Function Ubiquitin-protein transferase activity IDA 21988917, 22036506
GO:0004842 Function Ubiquitin-protein transferase activity IEA
GO:0005515 Function Protein binding IPI 22614015, 25026213, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610876 21033 ENSG00000085382
Protein
UniProt ID Q8IYU2
Protein name E3 ubiquitin-protein ligase HACE1 (EC 2.3.2.26) (HECT domain and ankyrin repeat-containing E3 ubiquitin-protein ligase 1) (HECT-type E3 ubiquitin transferase HACE1)
Protein function E3 ubiquitin-protein ligase involved in Golgi membrane fusion and regulation of small GTPases (PubMed:15254018, PubMed:21988917, PubMed:22036506, PubMed:37537642, PubMed:38332367). Acts as a regulator of Golgi membrane dynamics during the cell c
PDB 8H8X , 8HAE , 8PWL , 8Q0N
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12796 Ank_2 34 128 Ankyrin repeats (3 copies) Repeat
PF13637 Ank_4 131 184 Repeat
PF13637 Ank_4 164 217 Repeat
PF00632 HECT 602 909 HECT-domain (ubiquitin-transferase) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in multiple tissues including heart, brain and kidney. {ECO:0000269|PubMed:15254018}.
Sequence
MERAMEQLNRLTRSLRRARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYA
FGRVKRSLLHIAANCGSVECLVLLLKKGANPNYQDISGCTPLHLAARNGQKKCMSKLLEY
SADVNICN
NEGLTAIHWLAVNGRTELLHDLVQHVSDVDVEDAMGQTALHVACQNGHKTTV
QCLL
DSGADINRPNVSGATPLYFACSHGQRDTAQILL
LRGAKYLPDKNGVTPLDLCVQGG
YGETCEVLIQYHPRLFQTIIQMTQNEDLRENMLRQVLEHLSQQSESQYLKILTSLAEVAT
TNGHKLLSLSSNYDAQMKSLLRIVRMFCHVFRIGPSSPSNGIDMGYNGNKTPRSQVFKPL
ELLWHSLDEWLVLIATELMKNKRDSTEITSILLKQKGQDQDAASIPPFEPPGPGSYENLS
TGTRESKPDALAGRQEASADCQDVISMTANRLSAVIQAFYMCCSCQMPPGMTSPRFIEFV
CKHDEVLKCFVNRNPKIIFDHFHFLLECPELMSRFMHIIKAQPFKDRCEWFYEHLHSGQP
DSDMVHRPVNENDILLVHRDSIFRSSCEVVSKANCAKLKQGIAVRFHGEEGMGQGVVREW
FDILSNEIVNPDYALFTQSADGTTFQPNSNSYVNPDHLNYFRFAGQILGLALNHRQLVNI
YFTRSFYKHILGIPVNYQDVASIDPEYAKNLQWILDNDISDLGLELTFSVETDVFGAMEE
VPLKPGGGSILVTQNNKAEYVQLVTELRMTRAIQPQINAFLQGFHMFIPPSLIQLFDEYE
LELLLSGMPEIDVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSR
VPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALH
CGSYGYTMA
Sequence length 909
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Antigen processing: Ubiquitination & Proteasome degradation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Spastic Paraplegia-Severe Developmental Delay-Epilepsy Syndrome spastic paraplegia-severe developmental delay-epilepsy syndrome rs869025280, rs869025281, rs751809418, rs869025284, rs750371878, rs761086584, rs1337798545, rs1582418143, rs759641985 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Glioblastoma Glioblastoma N/A N/A GWAS
Hypertension Resistant hypertension N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Atrophy Associate 28584243
Carcinoma Hepatocellular Inhibit 33455098
Colonic Neoplasms Inhibit 18630515
Colorectal Neoplasms Associate 18630515, 19528486
Developmental Disabilities Associate 26424145, 36553453
GATA2 Deficiency Associate 19965620, 23142381
Glioma Associate 34815381
Immunologic Deficiency Syndromes Associate 26424145
Intellectual Disability Associate 36553453
Intestinal Diseases Associate 28584243