Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5753
Gene name	Protein tyrosine kinase 6
Gene symbol	PTK6
Synonyms (NCBI Gene)	BRK
Chromosome	20
Chromosome location	20q13.33
Summary	The protein encoded by this gene is a cytoplasmic nonreceptor protein kinase which may function as an intracellular signal transducer in epithelial tissues. Overexpression of this gene in mammary epithelial cells leads to sensitization of the cells to epi

331

Show/Hide all (331)

miRTarBase ID	miRNA	Experiments	Reference
MIRT724964	hsa-miR-1228-3p	HITS-CLIP	19536157
MIRT724963	hsa-miR-1306-5p	HITS-CLIP	19536157
MIRT724962	hsa-miR-622	HITS-CLIP	19536157
MIRT724961	hsa-miR-1247-3p	HITS-CLIP	19536157
MIRT724960	hsa-miR-4532	HITS-CLIP	19536157
MIRT724959	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT686080	hsa-miR-1910-3p	HITS-CLIP	23313552
MIRT686079	hsa-miR-6511a-5p	HITS-CLIP	23313552
MIRT686077	hsa-miR-3614-5p	HITS-CLIP	23313552
MIRT686078	hsa-miR-6500-3p	HITS-CLIP	23313552
MIRT686075	hsa-miR-4257	HITS-CLIP	23313552
MIRT686076	hsa-miR-4740-3p	HITS-CLIP	23313552
MIRT686074	hsa-miR-1827	HITS-CLIP	23313552
MIRT686073	hsa-miR-377-5p	HITS-CLIP	23313552
MIRT686071	hsa-miR-6086	HITS-CLIP	23313552
MIRT686072	hsa-miR-2467-3p	HITS-CLIP	23313552
MIRT665150	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT665149	hsa-miR-652-5p	HITS-CLIP	23824327
MIRT665148	hsa-miR-942-3p	HITS-CLIP	23824327
MIRT665146	hsa-miR-3675-3p	HITS-CLIP	23824327
MIRT665147	hsa-miR-454-5p	HITS-CLIP	23824327
MIRT665144	hsa-miR-4470	HITS-CLIP	23824327
MIRT665145	hsa-miR-3926	HITS-CLIP	23824327
MIRT665143	hsa-miR-548s	HITS-CLIP	23824327
MIRT542525	hsa-miR-1273g-3p	PAR-CLIP	21572407
MIRT542524	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT542523	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT542522	hsa-miR-766-3p	PAR-CLIP	21572407
MIRT542521	hsa-miR-191-3p	PAR-CLIP	21572407
MIRT542520	hsa-miR-6776-5p	PAR-CLIP	21572407
MIRT542518	hsa-miR-4252	PAR-CLIP	21572407
MIRT542519	hsa-miR-661	PAR-CLIP	21572407
MIRT542517	hsa-miR-542-3p	PAR-CLIP	21572407
MIRT542516	hsa-miR-6512-3p	PAR-CLIP	21572407
MIRT542515	hsa-miR-6720-5p	PAR-CLIP	21572407
MIRT542514	hsa-miR-1262	PAR-CLIP	21572407
MIRT542513	hsa-miR-4701-3p	PAR-CLIP	21572407
MIRT542512	hsa-miR-6736-5p	PAR-CLIP	21572407
MIRT542511	hsa-miR-5587-5p	PAR-CLIP	21572407
MIRT542514	hsa-miR-1262	PAR-CLIP	27292025
MIRT542525	hsa-miR-1273g-3p	PAR-CLIP	27292025
MIRT686074	hsa-miR-1827	PAR-CLIP	27292025
MIRT686074	hsa-miR-1827	PAR-CLIP	27292025
MIRT686074	hsa-miR-1827	PAR-CLIP	27292025
MIRT686080	hsa-miR-1910-3p	PAR-CLIP	27292025
MIRT686080	hsa-miR-1910-3p	PAR-CLIP	27292025
MIRT686080	hsa-miR-1910-3p	PAR-CLIP	27292025
MIRT542521	hsa-miR-191-3p	PAR-CLIP	27292025
MIRT686072	hsa-miR-2467-3p	PAR-CLIP	27292025
MIRT686072	hsa-miR-2467-3p	PAR-CLIP	27292025
MIRT686072	hsa-miR-2467-3p	PAR-CLIP	27292025
MIRT686077	hsa-miR-3614-5p	PAR-CLIP	27292025
MIRT686077	hsa-miR-3614-5p	PAR-CLIP	27292025
MIRT686077	hsa-miR-3614-5p	PAR-CLIP	27292025
MIRT686073	hsa-miR-377-5p	PAR-CLIP	27292025
MIRT686073	hsa-miR-377-5p	PAR-CLIP	27292025
MIRT686073	hsa-miR-377-5p	PAR-CLIP	27292025
MIRT542518	hsa-miR-4252	PAR-CLIP	27292025
MIRT686075	hsa-miR-4257	PAR-CLIP	27292025
MIRT686075	hsa-miR-4257	PAR-CLIP	27292025
MIRT686075	hsa-miR-4257	PAR-CLIP	27292025
MIRT542513	hsa-miR-4701-3p	PAR-CLIP	27292025
MIRT686076	hsa-miR-4740-3p	PAR-CLIP	27292025
MIRT686076	hsa-miR-4740-3p	PAR-CLIP	27292025
MIRT686076	hsa-miR-4740-3p	PAR-CLIP	27292025
MIRT542517	hsa-miR-542-3p	PAR-CLIP	27292025
MIRT542511	hsa-miR-5587-5p	PAR-CLIP	27292025
MIRT686071	hsa-miR-6086	PAR-CLIP	27292025
MIRT686071	hsa-miR-6086	PAR-CLIP	27292025
MIRT686071	hsa-miR-6086	PAR-CLIP	27292025
MIRT686078	hsa-miR-6500-3p	PAR-CLIP	27292025
MIRT686078	hsa-miR-6500-3p	PAR-CLIP	27292025
MIRT686078	hsa-miR-6500-3p	PAR-CLIP	27292025
MIRT686079	hsa-miR-6511a-5p	PAR-CLIP	27292025
MIRT686079	hsa-miR-6511a-5p	PAR-CLIP	27292025
MIRT686079	hsa-miR-6511a-5p	PAR-CLIP	27292025
MIRT542516	hsa-miR-6512-3p	PAR-CLIP	27292025
MIRT542515	hsa-miR-6720-5p	PAR-CLIP	27292025
MIRT542512	hsa-miR-6736-5p	PAR-CLIP	27292025
MIRT542523	hsa-miR-6742-3p	PAR-CLIP	27292025
MIRT542520	hsa-miR-6776-5p	PAR-CLIP	27292025
MIRT542522	hsa-miR-766-3p	PAR-CLIP	27292025
MIRT724964	hsa-miR-1228-3p	HITS-CLIP	19536157
MIRT724963	hsa-miR-1306-5p	HITS-CLIP	19536157
MIRT724962	hsa-miR-622	HITS-CLIP	19536157
MIRT724961	hsa-miR-1247-3p	HITS-CLIP	19536157
MIRT724960	hsa-miR-4532	HITS-CLIP	19536157
MIRT724959	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT686080	hsa-miR-1910-3p	HITS-CLIP	23313552
MIRT686079	hsa-miR-6511a-5p	HITS-CLIP	23313552
MIRT686077	hsa-miR-3614-5p	HITS-CLIP	23313552
MIRT686078	hsa-miR-6500-3p	HITS-CLIP	23313552
MIRT686075	hsa-miR-4257	HITS-CLIP	23313552
MIRT686076	hsa-miR-4740-3p	HITS-CLIP	23313552
MIRT686074	hsa-miR-1827	HITS-CLIP	23313552
MIRT686073	hsa-miR-377-5p	HITS-CLIP	23313552
MIRT686071	hsa-miR-6086	HITS-CLIP	23313552
MIRT686072	hsa-miR-2467-3p	HITS-CLIP	23313552
MIRT665150	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT665149	hsa-miR-652-5p	HITS-CLIP	23824327
MIRT665148	hsa-miR-942-3p	HITS-CLIP	23824327
MIRT665146	hsa-miR-3675-3p	HITS-CLIP	23824327
MIRT665147	hsa-miR-454-5p	HITS-CLIP	23824327
MIRT665144	hsa-miR-4470	HITS-CLIP	23824327
MIRT665145	hsa-miR-3926	HITS-CLIP	23824327
MIRT665143	hsa-miR-548s	HITS-CLIP	23824327
MIRT542525	hsa-miR-1273g-3p	PAR-CLIP	21572407
MIRT542524	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT542523	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT542522	hsa-miR-766-3p	PAR-CLIP	21572407
MIRT542521	hsa-miR-191-3p	PAR-CLIP	21572407
MIRT542520	hsa-miR-6776-5p	PAR-CLIP	21572407
MIRT542518	hsa-miR-4252	PAR-CLIP	21572407
MIRT542519	hsa-miR-661	PAR-CLIP	21572407
MIRT542517	hsa-miR-542-3p	PAR-CLIP	21572407
MIRT542516	hsa-miR-6512-3p	PAR-CLIP	21572407
MIRT542515	hsa-miR-6720-5p	PAR-CLIP	21572407
MIRT542514	hsa-miR-1262	PAR-CLIP	21572407
MIRT542513	hsa-miR-4701-3p	PAR-CLIP	21572407
MIRT542512	hsa-miR-6736-5p	PAR-CLIP	21572407
MIRT542511	hsa-miR-5587-5p	PAR-CLIP	21572407
MIRT1273575	hsa-miR-122	CLIP-seq
MIRT1273576	hsa-miR-1273f	CLIP-seq
MIRT1273577	hsa-miR-1289	CLIP-seq
MIRT1273578	hsa-miR-129-5p	CLIP-seq
MIRT1273579	hsa-miR-1307	CLIP-seq
MIRT1273580	hsa-miR-143	CLIP-seq
MIRT1273581	hsa-miR-2276	CLIP-seq
MIRT1273582	hsa-miR-3135b	CLIP-seq
MIRT1273583	hsa-miR-3149	CLIP-seq
MIRT1273584	hsa-miR-3198	CLIP-seq
MIRT1273585	hsa-miR-3652	CLIP-seq
MIRT1273586	hsa-miR-411	CLIP-seq
MIRT1273587	hsa-miR-4284	CLIP-seq
MIRT1273588	hsa-miR-4294	CLIP-seq
MIRT1273589	hsa-miR-4309	CLIP-seq
MIRT1273590	hsa-miR-4430	CLIP-seq
MIRT1273591	hsa-miR-4438	CLIP-seq
MIRT1273592	hsa-miR-4534	CLIP-seq
MIRT1273593	hsa-miR-4634	CLIP-seq
MIRT1273594	hsa-miR-4638-5p	CLIP-seq
MIRT1273595	hsa-miR-4707-3p	CLIP-seq
MIRT1273596	hsa-miR-4708-5p	CLIP-seq
MIRT1273597	hsa-miR-4735-5p	CLIP-seq
MIRT1273598	hsa-miR-4770	CLIP-seq
MIRT1273599	hsa-miR-4775	CLIP-seq
MIRT1273600	hsa-miR-483-5p	CLIP-seq
MIRT1273601	hsa-miR-5095	CLIP-seq
MIRT1273602	hsa-miR-590-3p	CLIP-seq
MIRT1273603	hsa-miR-720	CLIP-seq
MIRT1273593	hsa-miR-4634	CLIP-seq
MIRT2080468	hsa-miR-106a	CLIP-seq
MIRT2080469	hsa-miR-106b	CLIP-seq
MIRT1273575	hsa-miR-122	CLIP-seq
MIRT2080470	hsa-miR-125a-3p	CLIP-seq
MIRT1273576	hsa-miR-1273f	CLIP-seq
MIRT1273577	hsa-miR-1289	CLIP-seq
MIRT1273579	hsa-miR-1307	CLIP-seq
MIRT1273580	hsa-miR-143	CLIP-seq
MIRT2080471	hsa-miR-150	CLIP-seq
MIRT2080472	hsa-miR-17	CLIP-seq
MIRT2080473	hsa-miR-1976	CLIP-seq
MIRT2080474	hsa-miR-20a	CLIP-seq
MIRT2080475	hsa-miR-20b	CLIP-seq
MIRT1273581	hsa-miR-2276	CLIP-seq
MIRT2080476	hsa-miR-2278	CLIP-seq
MIRT2080477	hsa-miR-302a	CLIP-seq
MIRT2080478	hsa-miR-302b	CLIP-seq
MIRT2080479	hsa-miR-302c	CLIP-seq
MIRT2080480	hsa-miR-302d	CLIP-seq
MIRT2080481	hsa-miR-302e	CLIP-seq
MIRT1273582	hsa-miR-3135b	CLIP-seq
MIRT2080482	hsa-miR-3158-5p	CLIP-seq
MIRT1273584	hsa-miR-3198	CLIP-seq
MIRT1273585	hsa-miR-3652	CLIP-seq
MIRT2080483	hsa-miR-372	CLIP-seq
MIRT2080484	hsa-miR-373	CLIP-seq
MIRT2080485	hsa-miR-3934	CLIP-seq
MIRT1273587	hsa-miR-4284	CLIP-seq
MIRT1273588	hsa-miR-4294	CLIP-seq
MIRT1273589	hsa-miR-4309	CLIP-seq
MIRT1273590	hsa-miR-4430	CLIP-seq
MIRT1273591	hsa-miR-4438	CLIP-seq
MIRT1273592	hsa-miR-4534	CLIP-seq
MIRT1273593	hsa-miR-4634	CLIP-seq
MIRT1273594	hsa-miR-4638-5p	CLIP-seq
MIRT1273596	hsa-miR-4708-5p	CLIP-seq
MIRT1273598	hsa-miR-4770	CLIP-seq
MIRT1273601	hsa-miR-5095	CLIP-seq
MIRT2080486	hsa-miR-519d	CLIP-seq
MIRT2080487	hsa-miR-520a-3p	CLIP-seq
MIRT2080488	hsa-miR-520b	CLIP-seq
MIRT2080489	hsa-miR-520c-3p	CLIP-seq
MIRT2080490	hsa-miR-520d-3p	CLIP-seq
MIRT2080491	hsa-miR-520e	CLIP-seq
MIRT2080492	hsa-miR-520g	CLIP-seq
MIRT2080493	hsa-miR-520h	CLIP-seq
MIRT2080494	hsa-miR-532-3p	CLIP-seq
MIRT2080495	hsa-miR-640	CLIP-seq
MIRT1273603	hsa-miR-720	CLIP-seq
MIRT2080496	hsa-miR-764	CLIP-seq
MIRT2080497	hsa-miR-93	CLIP-seq
MIRT2080468	hsa-miR-106a	CLIP-seq
MIRT2080469	hsa-miR-106b	CLIP-seq
MIRT1273575	hsa-miR-122	CLIP-seq
MIRT2306610	hsa-miR-1224-3p	CLIP-seq
MIRT2306611	hsa-miR-1228	CLIP-seq
MIRT2306612	hsa-miR-1260	CLIP-seq
MIRT2306613	hsa-miR-1260b	CLIP-seq
MIRT1273576	hsa-miR-1273f	CLIP-seq
MIRT2306614	hsa-miR-1280	CLIP-seq
MIRT1273577	hsa-miR-1289	CLIP-seq
MIRT1273579	hsa-miR-1307	CLIP-seq
MIRT1273580	hsa-miR-143	CLIP-seq
MIRT2080471	hsa-miR-150	CLIP-seq
MIRT2080472	hsa-miR-17	CLIP-seq
MIRT2080473	hsa-miR-1976	CLIP-seq
MIRT2080474	hsa-miR-20a	CLIP-seq
MIRT2080475	hsa-miR-20b	CLIP-seq
MIRT1273581	hsa-miR-2276	CLIP-seq
MIRT2080477	hsa-miR-302a	CLIP-seq
MIRT2080478	hsa-miR-302b	CLIP-seq
MIRT2080479	hsa-miR-302c	CLIP-seq
MIRT2080480	hsa-miR-302d	CLIP-seq
MIRT2080481	hsa-miR-302e	CLIP-seq
MIRT1273582	hsa-miR-3135b	CLIP-seq
MIRT2306615	hsa-miR-3166	CLIP-seq
MIRT2306616	hsa-miR-3173-3p	CLIP-seq
MIRT1273584	hsa-miR-3198	CLIP-seq
MIRT2306617	hsa-miR-3545-3p	CLIP-seq
MIRT1273585	hsa-miR-3652	CLIP-seq
MIRT2080483	hsa-miR-372	CLIP-seq
MIRT2080484	hsa-miR-373	CLIP-seq
MIRT2306618	hsa-miR-377	CLIP-seq
MIRT1273587	hsa-miR-4284	CLIP-seq
MIRT1273588	hsa-miR-4294	CLIP-seq
MIRT1273589	hsa-miR-4309	CLIP-seq
MIRT1273590	hsa-miR-4430	CLIP-seq
MIRT1273592	hsa-miR-4534	CLIP-seq
MIRT2306619	hsa-miR-4539	CLIP-seq
MIRT1273593	hsa-miR-4634	CLIP-seq
MIRT1273594	hsa-miR-4638-5p	CLIP-seq
MIRT1273596	hsa-miR-4708-5p	CLIP-seq
MIRT2306620	hsa-miR-4713-5p	CLIP-seq
MIRT1273598	hsa-miR-4770	CLIP-seq
MIRT2306621	hsa-miR-512-3p	CLIP-seq
MIRT2080486	hsa-miR-519d	CLIP-seq
MIRT2080487	hsa-miR-520a-3p	CLIP-seq
MIRT2080488	hsa-miR-520b	CLIP-seq
MIRT2080489	hsa-miR-520c-3p	CLIP-seq
MIRT2080490	hsa-miR-520d-3p	CLIP-seq
MIRT2080491	hsa-miR-520e	CLIP-seq
MIRT2080492	hsa-miR-520g	CLIP-seq
MIRT2080493	hsa-miR-520h	CLIP-seq
MIRT2080494	hsa-miR-532-3p	CLIP-seq
MIRT2306622	hsa-miR-548aa	CLIP-seq
MIRT2080495	hsa-miR-640	CLIP-seq
MIRT1273603	hsa-miR-720	CLIP-seq
MIRT2080497	hsa-miR-93	CLIP-seq
MIRT1273593	hsa-miR-4634	CLIP-seq
MIRT1273575	hsa-miR-122	CLIP-seq
MIRT1273576	hsa-miR-1273f	CLIP-seq
MIRT1273577	hsa-miR-1289	CLIP-seq
MIRT1273579	hsa-miR-1307	CLIP-seq
MIRT1273580	hsa-miR-143	CLIP-seq
MIRT1273581	hsa-miR-2276	CLIP-seq
MIRT1273582	hsa-miR-3135b	CLIP-seq
MIRT1273584	hsa-miR-3198	CLIP-seq
MIRT1273585	hsa-miR-3652	CLIP-seq
MIRT1273587	hsa-miR-4284	CLIP-seq
MIRT1273588	hsa-miR-4294	CLIP-seq
MIRT1273589	hsa-miR-4309	CLIP-seq
MIRT1273590	hsa-miR-4430	CLIP-seq
MIRT1273592	hsa-miR-4534	CLIP-seq
MIRT1273593	hsa-miR-4634	CLIP-seq
MIRT1273594	hsa-miR-4638-5p	CLIP-seq
MIRT1273596	hsa-miR-4708-5p	CLIP-seq
MIRT1273598	hsa-miR-4770	CLIP-seq
MIRT1273603	hsa-miR-720	CLIP-seq
MIRT1273575	hsa-miR-122	CLIP-seq
MIRT1273576	hsa-miR-1273f	CLIP-seq
MIRT1273577	hsa-miR-1289	CLIP-seq
MIRT1273578	hsa-miR-129-5p	CLIP-seq
MIRT1273579	hsa-miR-1307	CLIP-seq
MIRT1273580	hsa-miR-143	CLIP-seq
MIRT2080471	hsa-miR-150	CLIP-seq
MIRT1273581	hsa-miR-2276	CLIP-seq
MIRT1273582	hsa-miR-3135b	CLIP-seq
MIRT1273584	hsa-miR-3198	CLIP-seq
MIRT2604347	hsa-miR-3199	CLIP-seq
MIRT1273585	hsa-miR-3652	CLIP-seq
MIRT1273587	hsa-miR-4284	CLIP-seq
MIRT1273588	hsa-miR-4294	CLIP-seq
MIRT1273589	hsa-miR-4309	CLIP-seq
MIRT1273590	hsa-miR-4430	CLIP-seq
MIRT1273592	hsa-miR-4534	CLIP-seq
MIRT1273593	hsa-miR-4634	CLIP-seq
MIRT1273594	hsa-miR-4638-5p	CLIP-seq
MIRT1273596	hsa-miR-4708-5p	CLIP-seq
MIRT1273597	hsa-miR-4735-5p	CLIP-seq
MIRT1273598	hsa-miR-4770	CLIP-seq
MIRT1273599	hsa-miR-4775	CLIP-seq
MIRT2080492	hsa-miR-520g	CLIP-seq
MIRT2080493	hsa-miR-520h	CLIP-seq
MIRT2080494	hsa-miR-532-3p	CLIP-seq
MIRT1273602	hsa-miR-590-3p	CLIP-seq
MIRT2080495	hsa-miR-640	CLIP-seq
MIRT2604348	hsa-miR-662	CLIP-seq
MIRT1273603	hsa-miR-720	CLIP-seq
MIRT1273575	hsa-miR-122	CLIP-seq
MIRT1273576	hsa-miR-1273f	CLIP-seq
MIRT1273577	hsa-miR-1289	CLIP-seq
MIRT1273579	hsa-miR-1307	CLIP-seq
MIRT1273580	hsa-miR-143	CLIP-seq
MIRT1273581	hsa-miR-2276	CLIP-seq
MIRT1273582	hsa-miR-3135b	CLIP-seq
MIRT1273584	hsa-miR-3198	CLIP-seq
MIRT2604347	hsa-miR-3199	CLIP-seq
MIRT1273585	hsa-miR-3652	CLIP-seq
MIRT1273587	hsa-miR-4284	CLIP-seq
MIRT1273588	hsa-miR-4294	CLIP-seq
MIRT1273589	hsa-miR-4309	CLIP-seq
MIRT1273590	hsa-miR-4430	CLIP-seq
MIRT1273592	hsa-miR-4534	CLIP-seq
MIRT1273593	hsa-miR-4634	CLIP-seq
MIRT1273594	hsa-miR-4638-5p	CLIP-seq
MIRT1273596	hsa-miR-4708-5p	CLIP-seq
MIRT1273598	hsa-miR-4770	CLIP-seq
MIRT2080494	hsa-miR-532-3p	CLIP-seq
MIRT2604348	hsa-miR-662	CLIP-seq
MIRT1273603	hsa-miR-720	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
SP1	Unknown	11997104

Show/Hide all (47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001726	Component	Ruffle	IDA	15572663
GO:0001726	Component	Ruffle	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	EXP	16568091, 18719096, 18829532, 19393627, 20554524, 20606012, 22084245, 25733683, 26751287
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	TAS
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	10913193
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS	8036022
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	10913193, 15539407, 15572663, 16273093, 16568091, 17500595, 18719096, 19439179, 20700126, 22939624, 24728074, 25416956, 31515488, 31980649, 32296183, 32814053, 35512704
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	10913193
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	15572663
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0006468	Process	Protein phosphorylation	TAS	8036022
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007260	Process	Tyrosine phosphorylation of STAT protein	IDA	16568091, 17997837
GO:0010976	Process	Positive regulation of neuron projection development	IMP	17910947
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	IDA	15572663
GO:0016604	Component	Nuclear body	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0038128	Process	ERBB2 signaling pathway	TAS
GO:0042802	Function	Identical protein binding	IPI	15056653, 18719096, 19401189
GO:0042995	Component	Cell projection	IEA
GO:0045740	Process	Positive regulation of DNA replication	TAS
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	TAS
GO:0045787	Process	Positive regulation of cell cycle	TAS
GO:0045926	Process	Negative regulation of growth	IEA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	TAS
GO:0046777	Process	Protein autophosphorylation	IMP	12121988
GO:0060575	Process	Intestinal epithelial cell differentiation	IEA
GO:0061099	Process	Negative regulation of protein tyrosine kinase activity	IDA	15539407
GO:0071300	Process	Cellular response to retinoic acid	IMP	17910947

MIM	HGNC	e!Ensembl
602004	9617	ENSG00000101213

Q13882

Protein name

Protein-tyrosine kinase 6 (EC 2.7.10.2) (Breast tumor kinase) (Tyrosine-protein kinase BRK)

Protein function

Non-receptor tyrosine-protein kinase implicated in the regulation of a variety of signaling pathways that control the differentiation and maintenance of normal epithelia, as well as tumor growth. Function seems to be context dependent and differ

PDB

1RJA , 2KGT , 5D7V , 5DA3 , 5H2U , 6CZ2 , 6CZ3 , 6CZ4 , 8S1C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	14 → 64	SH3 domain	Domain
PF00017	SH2	78 → 155	SH2 domain	Domain
PF07714	PK_Tyr_Ser-Thr	191 → 441	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Epithelia-specific. Very high level in colon and high levels in small intestine and prostate, and low levels in some fetal tissues. Not expressed in breast or ovarian tissue but expressed in high percentage of breast and ovarian cancer

Sequence

MVSRDQAHLGPKYVGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQG
YVPHNYLAERETVESEPWFFGCISRSEAVRRLQAEGNATGAFLIRVSEKPSADYVLSVRD
TQAVRHYKIWRRAGGRLHLNEAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPH
WDDWERPREEFTLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRDNLLHQQMLQSEIQAMK
KLRHKHILALYAVVSVGDPVYIITELMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGM
CYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDVYLSHDHNIPYKWTAPEALS
RGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLM
LTCWCRDPEQRPCFKALRERLSSFTSYENPT

Sequence length

451

Interactions

View interactions

	Reactome
			SCF(Skp2)-mediated degradation of p27/p21 Cyclin D associated events in G1 ERBB2 Activates PTK6 Signaling PTK6 Regulates Proteins Involved in RNA Processing PTK6 Regulates RTKs and Their Effectors AKT1 and DOK1 PTK6 Regulates Cell Cycle PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases PTK6 Down-Regulation PTK6 Expression PTK6 Activates STAT3 PTK6 promotes HIF1A stabilization

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Keratoconus	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (41)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma Follicular	Associate	25748447	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	35029906	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	26519433	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Associate	32512817	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	17299391, 17997837, 18781181, 19661439, 20554524, 20668531, 20700126, 21205088, 22231447, 23707532, 24523872, 25019382, 26825173, 29879184, 30651078 View all (5 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Stimulate	21603980	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Associate	32657779	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	18781181	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Associate	27311570	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Associate	30651078	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	21603980	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	38581999	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	33109128	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Associate	36546234	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Associate	20668531, 29879184	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	25019382	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Stimulate	26825173	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Stimulate	25019382	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	30590402	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	36854171	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Stimulate	21603980	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	16651629	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma T Cell Cutaneous	Associate	16651629	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	21603980	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	23758975	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neointima	Stimulate	24523872	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	17299391, 23758975, 26825173, 32657779, 37932734	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	16855388, 18781181, 19661439, 20668531, 20700126, 21479203, 21603980, 23497344, 24523872, 24788754, 25019382, 27107440, 27311570, 29879184, 29991529 View all (7 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Cystic Mucinous and Serous	Associate	16855388	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Squamous Cell	Associate	27311570	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	16855388, 20668531, 23814047	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	24788754, 32537471	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	20953141, 25491628, 31278310, 32264916	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatitis	Associate	20953141, 21479203	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Inhibit	23497344	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Associate	25748447	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	25748447	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	25748447	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	26825173, 27107440, 29991529, 37932734	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	27311570, 35894144	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Associate	36690663	★★★★★ ★☆☆☆☆ Found in Text Mining only

PTK6 (protein tyrosine kinase 6)