Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	57514
Gene name Gene Name - the full gene name approved by the HGNC.	Rho GTPase activating protein 31
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ARHGAP31
Synonyms (NCBI Gene) Gene synonyms aliases	AOS, AOS1, CDGAP
Disease Acronyms (UniProt) Disease acronyms from UniProt database	AOS1
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q13.32-q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a GTPase-activating protein (GAP). A variety of cellular processes are regulated by Rho GTPases which cycle between an inactive form bound to GDP and an active form bound to GTP. This cycling between inactive and active forms is regulate

Show/Hide all(8)

SNP ID	Visualize variation	Clinical significance	Consequence
rs139733647	G>A,T	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs200233879	C>A,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, missense variant
rs200598971	C>G,T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs201519981	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant, 5 prime UTR variant
rs201927115	C>G	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, synonymous variant, 5 prime UTR variant
rs387907031	C>T	Pathogenic	Coding sequence variant, stop gained
rs1553768038	C>T	Pathogenic	Stop gained, coding sequence variant
rs1559999373	A>-	Pathogenic	Frameshift variant, coding sequence variant

Show/Hide all(182)

miRTarBase ID	miRNA	Experiments	Reference
MIRT660539	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT660538	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT660537	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT660536	hsa-miR-576-5p	HITS-CLIP	23824327
MIRT660535	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT494723	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT494724	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT494722	hsa-miR-1321	PAR-CLIP	23592263
MIRT494721	hsa-miR-4739	PAR-CLIP	23592263
MIRT494720	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT494719	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT494718	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT494717	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT494716	hsa-miR-4784	PAR-CLIP	23592263
MIRT494715	hsa-miR-4419a	PAR-CLIP	23592263
MIRT494714	hsa-miR-4510	PAR-CLIP	23592263
MIRT494713	hsa-miR-6127	PAR-CLIP	23592263
MIRT494712	hsa-miR-6129	PAR-CLIP	23592263
MIRT494711	hsa-miR-6130	PAR-CLIP	23592263
MIRT494710	hsa-miR-6133	PAR-CLIP	23592263
MIRT494708	hsa-miR-4706	PAR-CLIP	23592263
MIRT494709	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT494707	hsa-miR-765	PAR-CLIP	23592263
MIRT494706	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT494705	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT494704	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT494702	hsa-miR-663a	PAR-CLIP	23592263
MIRT494703	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT494701	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT494700	hsa-miR-8085	PAR-CLIP	23592263
MIRT494698	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT494699	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT494697	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT494696	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT494695	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT494693	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT494694	hsa-miR-4730	PAR-CLIP	23592263
MIRT494692	hsa-miR-6770-3p	PAR-CLIP	23592263
MIRT660539	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT660538	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT660537	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT660536	hsa-miR-576-5p	HITS-CLIP	23824327
MIRT660535	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT494723	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT494724	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT494722	hsa-miR-1321	PAR-CLIP	23592263
MIRT494721	hsa-miR-4739	PAR-CLIP	23592263
MIRT494720	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT494719	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT494718	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT494717	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT494716	hsa-miR-4784	PAR-CLIP	23592263
MIRT494715	hsa-miR-4419a	PAR-CLIP	23592263
MIRT494714	hsa-miR-4510	PAR-CLIP	23592263
MIRT494713	hsa-miR-6127	PAR-CLIP	23592263
MIRT494712	hsa-miR-6129	PAR-CLIP	23592263
MIRT494711	hsa-miR-6130	PAR-CLIP	23592263
MIRT494710	hsa-miR-6133	PAR-CLIP	23592263
MIRT494708	hsa-miR-4706	PAR-CLIP	23592263
MIRT494709	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT494707	hsa-miR-765	PAR-CLIP	23592263
MIRT494706	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT494705	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT494704	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT494702	hsa-miR-663a	PAR-CLIP	23592263
MIRT494703	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT494701	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT494700	hsa-miR-8085	PAR-CLIP	23592263
MIRT494698	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT494699	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT494697	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT494696	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT494695	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT494693	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT494694	hsa-miR-4730	PAR-CLIP	23592263
MIRT494692	hsa-miR-6770-3p	PAR-CLIP	23592263
MIRT794451	hsa-miR-1245b-3p	CLIP-seq
MIRT794452	hsa-miR-1279	CLIP-seq
MIRT794453	hsa-miR-1294	CLIP-seq
MIRT794454	hsa-miR-1324	CLIP-seq
MIRT794455	hsa-miR-1343	CLIP-seq
MIRT794456	hsa-miR-140-3p	CLIP-seq
MIRT794457	hsa-miR-150	CLIP-seq
MIRT794458	hsa-miR-185	CLIP-seq
MIRT794459	hsa-miR-2110	CLIP-seq
MIRT794460	hsa-miR-3125	CLIP-seq
MIRT794461	hsa-miR-3147	CLIP-seq
MIRT794462	hsa-miR-3148	CLIP-seq
MIRT794463	hsa-miR-3176	CLIP-seq
MIRT794464	hsa-miR-3202	CLIP-seq
MIRT794465	hsa-miR-320a	CLIP-seq
MIRT794466	hsa-miR-320b	CLIP-seq
MIRT794467	hsa-miR-320c	CLIP-seq
MIRT794468	hsa-miR-320d	CLIP-seq
MIRT794469	hsa-miR-340	CLIP-seq
MIRT794470	hsa-miR-3545-3p	CLIP-seq
MIRT794471	hsa-miR-3663-5p	CLIP-seq
MIRT794472	hsa-miR-3688-3p	CLIP-seq
MIRT794473	hsa-miR-378g	CLIP-seq
MIRT794474	hsa-miR-3916	CLIP-seq
MIRT794475	hsa-miR-3922-3p	CLIP-seq
MIRT794476	hsa-miR-3942-3p	CLIP-seq
MIRT794477	hsa-miR-3976	CLIP-seq
MIRT794478	hsa-miR-4267	CLIP-seq
MIRT794479	hsa-miR-4271	CLIP-seq
MIRT794480	hsa-miR-4306	CLIP-seq
MIRT794481	hsa-miR-4316	CLIP-seq
MIRT794482	hsa-miR-4326	CLIP-seq
MIRT794483	hsa-miR-4423-5p	CLIP-seq
MIRT794484	hsa-miR-4425	CLIP-seq
MIRT794485	hsa-miR-4429	CLIP-seq
MIRT794486	hsa-miR-4437	CLIP-seq
MIRT794487	hsa-miR-450b-3p	CLIP-seq
MIRT794488	hsa-miR-4533	CLIP-seq
MIRT794489	hsa-miR-4635	CLIP-seq
MIRT794490	hsa-miR-4644	CLIP-seq
MIRT794491	hsa-miR-4659a-3p	CLIP-seq
MIRT794492	hsa-miR-4659b-3p	CLIP-seq
MIRT794493	hsa-miR-4663	CLIP-seq
MIRT794494	hsa-miR-4667-5p	CLIP-seq
MIRT794495	hsa-miR-4668-5p	CLIP-seq
MIRT794496	hsa-miR-4674	CLIP-seq
MIRT794497	hsa-miR-4680-5p	CLIP-seq
MIRT794498	hsa-miR-4700-5p	CLIP-seq
MIRT794499	hsa-miR-4725-3p	CLIP-seq
MIRT794500	hsa-miR-488	CLIP-seq
MIRT794501	hsa-miR-520g	CLIP-seq
MIRT794502	hsa-miR-520h	CLIP-seq
MIRT794503	hsa-miR-576-3p	CLIP-seq
MIRT794504	hsa-miR-578	CLIP-seq
MIRT794505	hsa-miR-607	CLIP-seq
MIRT794506	hsa-miR-610	CLIP-seq
MIRT794507	hsa-miR-661	CLIP-seq
MIRT794508	hsa-miR-769-3p	CLIP-seq
MIRT1545502	hsa-miR-1908	CLIP-seq
MIRT794470	hsa-miR-3545-3p	CLIP-seq
MIRT794471	hsa-miR-3663-5p	CLIP-seq
MIRT794483	hsa-miR-4423-5p	CLIP-seq
MIRT794489	hsa-miR-4635	CLIP-seq
MIRT794497	hsa-miR-4680-5p	CLIP-seq
MIRT1545503	hsa-miR-663	CLIP-seq
MIRT1545504	hsa-miR-720	CLIP-seq
MIRT1934469	hsa-miR-197	CLIP-seq
MIRT794463	hsa-miR-3176	CLIP-seq
MIRT794470	hsa-miR-3545-3p	CLIP-seq
MIRT794471	hsa-miR-3663-5p	CLIP-seq
MIRT794475	hsa-miR-3922-3p	CLIP-seq
MIRT1934470	hsa-miR-412	CLIP-seq
MIRT794483	hsa-miR-4423-5p	CLIP-seq
MIRT794489	hsa-miR-4635	CLIP-seq
MIRT794491	hsa-miR-4659a-3p	CLIP-seq
MIRT794492	hsa-miR-4659b-3p	CLIP-seq
MIRT794497	hsa-miR-4680-5p	CLIP-seq
MIRT1934471	hsa-miR-4742-3p	CLIP-seq
MIRT1934472	hsa-miR-615-5p	CLIP-seq
MIRT1545504	hsa-miR-720	CLIP-seq
MIRT2174297	hsa-miR-1273f	CLIP-seq
MIRT2174298	hsa-miR-300	CLIP-seq
MIRT2174299	hsa-miR-381	CLIP-seq
MIRT1934470	hsa-miR-412	CLIP-seq
MIRT794491	hsa-miR-4659a-3p	CLIP-seq
MIRT794492	hsa-miR-4659b-3p	CLIP-seq
MIRT1934471	hsa-miR-4742-3p	CLIP-seq
MIRT2174300	hsa-miR-4755-3p	CLIP-seq
MIRT1934472	hsa-miR-615-5p	CLIP-seq
MIRT1545504	hsa-miR-720	CLIP-seq
MIRT2384401	hsa-miR-205	CLIP-seq
MIRT2384402	hsa-miR-3690	CLIP-seq
MIRT2384403	hsa-miR-4254	CLIP-seq
MIRT2384404	hsa-miR-4268	CLIP-seq
MIRT2384405	hsa-miR-4287	CLIP-seq
MIRT2384406	hsa-miR-4633-3p	CLIP-seq
MIRT2384407	hsa-miR-4685-3p	CLIP-seq
MIRT2384408	hsa-miR-4793-5p	CLIP-seq
MIRT2384409	hsa-miR-544	CLIP-seq
MIRT2477929	hsa-miR-1183	CLIP-seq
MIRT2477930	hsa-miR-186	CLIP-seq
MIRT2477931	hsa-miR-3133	CLIP-seq
MIRT2477932	hsa-miR-3607-3p	CLIP-seq
MIRT2477933	hsa-miR-4297	CLIP-seq
MIRT2477934	hsa-miR-513b	CLIP-seq
MIRT2477935	hsa-miR-532-5p	CLIP-seq

Show/Hide all(8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005096	Function	GTPase activator activity	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0005925	Component	Focal adhesion	IEA
GO:0007264	Process	Small GTPase mediated signal transduction	IBA	21873635
GO:0017124	Function	SH3 domain binding	IEA
GO:0030027	Component	Lamellipodium	IBA	21873635
GO:0043547	Process	Positive regulation of GTPase activity	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS

MIM	HGNC	e!Ensembl
610911	29216	ENSG00000031081

Protein

UniProt ID

Q2M1Z3

Protein name

Rho GTPase-activating protein 31 (Cdc42 GTPase-activating protein)

Protein function

Functions as a GTPase-activating protein (GAP) for RAC1 and CDC42. Required for cell spreading, polarized lamellipodia formation and cell migration.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00620	RhoGAP	35 → 187	RhoGAP domain	Domain

Sequence

MKNKGAKQKLKRKGAASAFGCDLTEYLESSGQDVPYVLKSCAEFIETHGIVDGIYRLSGV
TSNIQRLRQEFGSDQCPDLTREVYLQDIHCVGSLCKLYFRELPNPLLTYELYEKFTEAVS
HCPEEGQLARIQNVIQELPPSHYRTLEYLIRHLAHIASFSSKTNMHARNLALVWAPNLLR
SKEIEATGCNGDAAFLAVRVQQVVIEFILNHVDQIFNNGAPGSLENDENRPIMKSLTLPA
LSLPMKLVSLEEAQARSLATNHPARKERRENSLPEIVPPMGTLFHTVLELPDNKRKLSSK
SKKWKSIFNLGRSGSDSKSKLSRNGSVFVRGQRLSVEKATIRPAKSMDSLCSVPVEGKET
KGNFNRTVTTGGFFIPATKMHSTGTGSSCDLTKQEGEWGQEGMPPGAEGGFDVSSDRSHL
QGAQARPPPEQLKVFRPVEDPESEQTAPKMLGMFYTSNDSPSKSVFTSSLFQMEPSPRNQ
RKALNISEPFAVSVPLRVSAVISTNSTPCRTPPKELQSLSSLEEFSFHGSESGGWPEEEK
PLGAETSAASVPKKAGLEDAKAVPEAPGTVECSKGLSQEPGAHLEEKKTPESSLSSQHLN
ELEKRPNPEKVVEEGREAGEMESSTLQESPRARAEAVLLHEMDEDDLANALIWPEIQQEL
KIIESEEELSSLPPPALKTSPIQPILESSLGPFIPSEPPGSLPCGSFPAPVSTPLEVWTR
DPANQSTQGASTAASREKPEPEQGLHPDLASLAPLEIVPFEKASPQATVEVGGPGNLSPP
LPPAPPPPTPLEESTPVLLSKGGPEREDSSRKLRTDLYIDQLKSQDSPEISSLCQGEEAT
PRHSDKQNSKNAASEGKGCGFPSPTREVEIVSQEEEDVTHSVQEPSDCDEDDTVTDIAQH
GLEMVEPWEEPQWVTSPLHSPTLKDAHKAQVQGLQGHQLEKRLSHRPSLRQSHSLDSKPT
VKSQWTLEVPSSSSCANLETERNSDPLQPQAPRREITGWDEKALRSFREFSGLKGAEAPP
NQKGPSGVQPNPAETSPISLAEGKELGTHLGHSSPQIRQGGVPGPESSKESSPSVQDSTS
PGEHPAKLQLKSTECGPPKGKNRPSSLNLDPAIPIADLFWFENVASFSSPGMQVSEPGDP
KVTWMTSSYCKADPWRVYSQDPQDLDIVAHALTGRRNSAPVSVSAVRTSFMVKMCQARAV
PVIPPKIQYTQIPQPLPSQSSGENGVQPLERSQEGPSSTSGTTQKPAKDDSPSSLESSKE
EKPKQDPGAIKSSPVDATAPCMCEGPTLSPEPGSSNLLSTQDAVVQCRKRMSETEPSGDN
LLSSKLERPSGGSKPFHRSRPGRPQSLILFSPPFPIMDHLPPSSTVTDSKVLLSPIRSPT
QTVSPGLLCGELAENTWVTPEGVTLRNKMTIPKNGQRLETSTSCFYQPQRRSVILDGRSG
RQIE

Sequence length

1444

Interactions

View interactions

	Reactome
			Rho GTPase cycle

Show/Hide Causal Diseases (20)

Disease term	Disease name	dbSNP ID	References
Causal
Adams-oliver syndrome	Adams Oliver syndrome, Adams-Oliver syndrome 1, Adams-Oliver syndrome	rs41309764, rs387907031, rs1559999373, rs1226716539, rs387907270, rs387907271, rs397509398, rs397509399, rs587776993, rs587776994, rs587776995, rs587781259, rs587777735, rs587777736, rs730882238 View all (56 more)	21565291, 29924900, 28160419, 474617
Aplasia cutis congenita	Aplasia Cutis Congenita, Aplasia cutis congenita over posterior parietal area, Congenital defect of skull and scalp	rs587777706
Atrial septal defect	Atrial Septal Defects	rs137852951, rs137852953, rs137852955, rs267607106, rs104893900, rs104893901, rs104893903, rs606231358, rs606231359, rs137852683, rs606231360, rs104893907, rs104894073, rs1585703301, rs104894074 View all (25 more)
Autoimmune diseases	Autoimmune Diseases, AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1, AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 2	rs869025224	30595370, 21383967
Bicuspid aortic valve	Bicuspid aortic valve	rs1569484234, rs1569484208
Brachydactyly	Brachydactyly	rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852 View all (22 more)
Cataract	Cataract	rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322 View all (150 more)
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)
Hydrocephalus	Hydrocephalus	rs387907320, rs369384363, rs387907321, rs372127610, rs770273135, rs797045095, rs797045707, rs769795916, rs781251438, rs922703465, rs376078512, rs1567043467, rs1587149916, rs1586841546
Hypertension	Hypertensive disease	rs13306026
Hypoplastic left heart syndrome	Hypoplastic Left Heart Syndrome	rs1554284604, rs1843006535
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959
Mental retardation	Intellectual Disability	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)
Microcephaly	Microcephaly	rs397704721, rs267607176, rs267607177, rs397704725, rs267606717, rs267606718, rs199422202, rs121434311, rs199422203, rs199422126, rs387906274, rs121434305, rs199422125, rs199422135, rs189678019 View all (280 more)
Microphthalmos	Microphthalmos	rs794726862, rs1329285216
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039 View all (4 more)	22190364
Polymicrogyria	Polymicrogyria	rs1558010146, rs1558003446, rs1575508937
Pulmonary arterial hypertension	Pulmonary arterial hypertension, Idiopathic pulmonary arterial hypertension	rs121909288, rs137852741, rs137852742, rs137852743, rs137852744, rs137852745, rs137852746, rs137852748, rs137852749, rs137852750, rs137852751, rs137852753, rs863223423, rs863223426, rs863223424 View all (116 more)
Tetralogy of fallot	Tetralogy of Fallot	rs28939668, rs727504412, rs864321649, rs774966208, rs876660981, rs886044220, rs1114167357, rs1569484126, rs1569484164, rs1569484122, rs1569484124, rs1569484042, rs1569484120, rs1569484299, rs1569484301, rs1569484288 View all (1 more)
Ventricular septal defect	Ventricular Septal Defects	rs104894073, rs387906775

Show/Hide Unknown Diseases (6)

Disease term	Disease name	References	Source
Unknown
Asthma	Asthma	21150878	ClinVar
Celiac disease	Celiac Disease, Celiac disease	20190752, 22057235	ClinVar, GWAS
Cirrhosis	Cirrhosis		ClinVar
Porencephalic cyst	Porencephalic cyst		ClinVar
Adams-Oliver Syndrome	Adams-Oliver syndrome		GenCC
Schizophrenia	Schizophrenia		GWAS

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References
Associations from Text Mining
Adams Oliver syndrome	Associate	21565291, 26299364, 29924900, 33655927
Anophthalmos with limb anomalies	Associate	21565291
Attention Deficit Disorder with Hyperactivity	Associate	21651830
Central Nervous System Vascular Malformations	Associate	33655927
Coronary Artery Disease	Associate	17357071, 19706030
Ectodermal Dysplasia	Associate	21565291
Familial Exudative Vitreoretinopathies	Associate	33655927
Hypertensive Retinopathy	Associate	33655927
Lupus Erythematosus Systemic	Associate	25890262
Microcephaly	Associate	33655927
Neoplasms	Associate	23319410
Retinal Detachment	Associate	33655927
Ventricular Outflow Obstruction Left	Associate	27760138

ARHGAP31 (Rho GTPase activating protein 31)