LRFN2 (leucine rich repeat and fibronectin type III domain containing 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57497
Gene name Gene Name - the full gene name approved by the HGNC.
Leucine rich repeat and fibronectin type III domain containing 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LRFN2
Synonyms (NCBI Gene) Gene synonyms aliases
FIGLER2, KIAA1246, SALM1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.2-p21.1
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(5)
miRTarBase ID miRNA Experiments Reference
MIRT1117518 hsa-miR-4278 CLIP-seq
MIRT1117519 hsa-miR-4706 CLIP-seq
MIRT1117520 hsa-miR-4716-3p CLIP-seq
MIRT1117521 hsa-miR-4749-5p CLIP-seq
MIRT1117522 hsa-miR-744 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0009986 Component Cell surface IBA
GO:0009986 Component Cell surface IEA
GO:0016020 Component Membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
612808 21226 ENSG00000156564
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9ULH4
Protein name Leucine-rich repeat and fibronectin type-III domain-containing protein 2 (Synaptic adhesion-like molecule 1)
Protein function Promotes neurite outgrowth in hippocampal neurons. Enhances the cell surface expression of 2 NMDA receptor subunits GRIN1 and GRIN2A. May play a role in redistributing DLG4 to the cell periphery (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 52 → 112 Leucine rich repeat Repeat
PF13855 LRR_8 124 → 185 Leucine rich repeat Repeat
PF13855 LRR_8 173 → 218 Leucine rich repeat Repeat
PF07679 I-set 289 → 376 Immunoglobulin I-set domain Domain
PF00041 fn3 420 → 500 Fibronectin type III domain Domain
Sequence 
METLLGGLLAFGMAFAVVDACPKYCVCQNLSESLGTLCPSKGLLFVPPDIDRRTVELRLG
GNFIIHISRQDFANMTGLVDLTLSRNTISHIQPFSFLDLESLRSLHLDSNRLPSLGEDTL
RGLVNLQHLIVNNNQLGGIADEAFEDFLLTLEDLDLSYNNLHGLPWDSVRRMVNLHQLSL
DHNLLDHIAEGTFADLQKLARLDLTSNRLQKLPPDPIFARSQASALTATPFAPPLSFSFG
GNPLHCNCELLWLRRLERDDDLETCGSPGGLKGRYFWHVREEEFVCEPPLITQHTHKLLV
LEGQAATLKCKAIGDPSPLIHWVAPDDRLVGNSSRTAVYDNGTLDIFITTSQDSGAFTCI
AANAAGEATAMVEVSIVQLPHLSNSTSRTAPPKSRLSDITGSSKTSRGGGGSGGGEPPKS
PPERAVLVSEVTTTSALVKWSVSKSAPRVKMYQLQYNCSDDEVLIYRMIPASNKAFVVNN
LVSGTGYDLCVLAMWDDTATTLTATNIVGCAQFFTKADYPQCQSMHSQILGGTMILVIGG
IIVATLLVFIVILMVRYKVCNHEAPSKMAAAVSNVYSQTNGAQPPPPSSAPAGAPPQGPP
KVVVRNELLDFTASLARASDSSSSSSLGSGEAAGLGRAPWRIPPSAPRPKPSLDRLMGAF
ASLDLKSQRKEELLDSRTPAGRGAGTSARGHHSDREPLLGPPAARARSLLPLPLEGKAKR
SHSFDMGDFAAAAAGGVVPGGYSPPRKVSNIWTKRSLSVNGMLLPFEESDLVGARGTFGS
SEWVMESTV
Sequence length 789
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Synaptic adhesion-like molecules
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (7)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Diabetes Type 2 diabetes, Mild age-related type 2 diabetes N/A N/A GWAS
Heart Failure Heart failure N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Show/Hide Text Mining Associations (10)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Antisocial Personality Disorder Associate 27598967
Cognition Disorders Associate 29324989
Esophageal Neoplasms Associate 32880595
Esophageal Neoplasms Inhibit 35879265
Esophageal Squamous Cell Carcinoma Associate 31053115
Head and Neck Neoplasms Associate 25524939
Laryngeal Neoplasms Associate 27765935
Neoplasms Associate 23103227, 35879265
Ovarian Neoplasms Associate 24528012
Personality Disorders Associate 27598967