Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5747
Gene name Gene Name - the full gene name approved by the HGNC.
Protein tyrosine kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PTK2
Synonyms (NCBI Gene) Gene synonyms aliases
FADK, FADK 1, FAK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protei
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004001 hsa-miR-193a-3p Luciferase reporter assay, qRT-PCR, Western blot 18381414
MIRT006388 hsa-miR-138-5p Luciferase reporter assay, Western blot 21444814
MIRT006388 hsa-miR-138-5p Luciferase reporter assay, Western blot 21444814
MIRT006388 hsa-miR-138-5p Luciferase reporter assay, Western blot 21444814
MIRT006900 hsa-miR-7-5p T47D 22876288
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade TAS
GO:0001525 Process Angiogenesis IBA 21873635
GO:0001525 Process Angiogenesis TAS 20552554
GO:0001725 Component Stress fiber IDA 24036928
GO:0001890 Process Placenta development TAS 20552554
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600758 9611 ENSG00000169398
Protein
UniProt ID Q05397
Protein name Focal adhesion kinase 1 (FADK 1) (EC 2.7.10.2) (Focal adhesion kinase-related nonkinase) (FRNK) (Protein phosphatase 1 regulatory subunit 71) (PPP1R71) (Protein-tyrosine kinase 2) (p125FAK) (pp125FAK)
Protein function Non-receptor protein-tyrosine kinase that plays an essential role in regulating cell migration, adhesion, spreading, reorganization of the actin cytoskeleton, formation and disassembly of focal adhesions and cell protrusions, cell cycle progress
PDB 1K04 , 1K05 , 1MP8 , 1OW6 , 1OW7 , 1OW8 , 2ETM , 2IJM , 3B71 , 3BZ3 , 3PXK , 3S9O , 4EBV , 4EBW , 4GU6 , 4GU9 , 4I4E , 4I4F , 4K8A , 4K9Y , 4KAB , 4KAO , 4NY0 , 4Q9S , 6I8Z , 6LES , 6PW8 , 6YOJ , 6YQ1 , 6YR9 , 6YT6 , 6YVS , 6YVY , 6YXV , 7PI4 , 7W7Z , 7W8B , 7W8I , 7W9U
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18038 FERM_N_2 35 130 FERM N-terminal domain Domain
PF00373 FERM_M 133 258 FERM central domain Domain
PF07714 PK_Tyr_Ser-Thr 422 676 Protein tyrosine and serine/threonine kinase Domain
PF03623 Focal_AT 914 1046 Focal adhesion targeting region Domain
Tissue specificity TISSUE SPECIFICITY: Detected in B and T-lymphocytes. Isoform 1 and isoform 6 are detected in lung fibroblasts (at protein level). Ubiquitous. Expressed in epithelial cells (at protein level) (PubMed:31630787). {ECO:0000269|PubMed:20109444, ECO:0000269|Pub
Sequence
MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLP
KGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECF
KCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFII
RPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQL
STILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQE
IAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNE
GVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLA
LRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQM
LTAAHALAVDAKNLLDVIDQARLKML
GQTRPH
Sequence length 1052
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Endocrine resistance
ErbB signaling pathway
Chemokine signaling pathway
Efferocytosis
PI3K-Akt signaling pathway
Axon guidance
VEGF signaling pathway
Focal adhesion
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Growth hormone synthesis, secretion and action
Bacterial invasion of epithelial cells
Shigellosis
Yersinia infection
Amoebiasis
Human cytomegalovirus infection
Human papillomavirus infection
Human immunodeficiency virus 1 infection
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
Chemical carcinogenesis - reactive oxygen species
Small cell lung cancer
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis
  Apoptotic cleavage of cellular proteins
Regulation of actin dynamics for phagocytic cup formation
Integrin signaling
GRB2:SOS provides linkage to MAPK signaling for Integrins
p130Cas linkage to MAPK signaling for integrins
NCAM signaling for neurite out-growth
EPHB-mediated forward signaling
DCC mediated attractive signaling
VEGFA-VEGFR2 Pathway
RHO GTPases Activate WASPs and WAVEs
RAF/MAP kinase cascade
MET activates PTK2 signaling
Extra-nuclear estrogen signaling
Estrogen-dependent nuclear events downstream of ESR-membrane signaling
FCGR3A-mediated phagocytosis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Atrial fibrillation Atrial Fibrillation rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557
View all (6 more)
29892015, 30061737
Carcinoma Squamous cell carcinoma rs121912654, rs555607708, rs786202962, rs1564055259 21401805, 25199511
Glioblastoma Glioblastoma, Glioblastoma Multiforme rs121913500, rs886042842, rs1555138291, rs1558518449, rs1567176006, rs1558650888 12811834
Non-obstructive azoospermia Non-obstructive azoospermia rs587777872, rs879253743, rs1600840291, rs1600877766, rs753462162, rs1588618614, rs1602684496, rs377712900 22197933
Unknown
Disease term Disease name Evidence References Source
Paroxysmal atrial fibrillation Paroxysmal atrial fibrillation 29892015, 30061737 ClinVar
Atrial Fibrillation Atrial Fibrillation GWAS
Restless Legs Syndrome Restless Legs Syndrome GWAS
Dermatitis Dermatitis GWAS
Associations from Text Mining
Disease Name Relationship Type References
Achalasia Addisonianism Alacrimia syndrome Associate 25326692
Adenocarcinoma Associate 31291201
Adenocarcinoma Follicular Stimulate 15483349
Adenocarcinoma of Lung Associate 23874428, 26556867, 26631041, 28928239, 33215807, 37311571
Adenoma Associate 15483349
Adenomyosis Associate 30365102
Aging Premature Associate 35069971
Alzheimer Disease Associate 36039594
Anophthalmia with pulmonary hypoplasia Associate 26119934
Arterial Tortuosity Syndrome Associate 26376865