Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5747
Gene name	Protein tyrosine kinase 2
Gene symbol	PTK2
Synonyms (NCBI Gene)	FADKFADK 1FAKFAK1FRNKPPP1R71p125FAKpp125FAK
Chromosome	8
Chromosome location	8q24.3
Summary	This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protei

562

Show/Hide all (562)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004001	hsa-miR-193a-3p	Luciferase reporter assayqRT-PCRWestern blot	18381414
MIRT006388	hsa-miR-138-5p	Luciferase reporter assayWestern blot	21444814
MIRT006388	hsa-miR-138-5p	Luciferase reporter assayWestern blot	21444814
MIRT006388	hsa-miR-138-5p	Luciferase reporter assayWestern blot	21444814
MIRT006900	hsa-miR-7-5p	T47D	22876288
MIRT006900	hsa-miR-7-5p	T47D	22876288
MIRT006900	hsa-miR-7-5p	T47D	22876288
MIRT006900	hsa-miR-7-5p	T47D	22876288
MIRT030918	hsa-miR-21-5p	Microarray	18591254
MIRT051867	hsa-let-7c-5p	CLASH	23622248
MIRT051491	hsa-let-7e-5p	CLASH	23622248
MIRT053172	hsa-miR-543	Luciferase reporter assayWestern blot	24699721
MIRT732163	hsa-miR-379-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26944318
MIRT732163	hsa-miR-379-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26944318
MIRT006900	hsa-miR-7-5p	Luciferase reporter assayqRT-PCRWestern blot	27764812
MIRT006900	hsa-miR-7-5p	Luciferase reporter assayqRT-PCRWestern blot	27764812
MIRT006900	hsa-miR-7-5p	Luciferase reporter assay	25785020
MIRT006900	hsa-miR-7-5p	Luciferase reporter assay	25785020
MIRT006900	hsa-miR-7-5p	Luciferase reporter assayWestern blottingqRT-PCR	31522588
MIRT1273410	hsa-miR-106a	CLIP-seq
MIRT1273411	hsa-miR-106b	CLIP-seq
MIRT1273412	hsa-miR-1197	CLIP-seq
MIRT1273413	hsa-miR-1200	CLIP-seq
MIRT1273414	hsa-miR-1224-5p	CLIP-seq
MIRT1273415	hsa-miR-1236	CLIP-seq
MIRT1273416	hsa-miR-1238	CLIP-seq
MIRT1273417	hsa-miR-1264	CLIP-seq
MIRT1273418	hsa-miR-1273	CLIP-seq
MIRT1273419	hsa-miR-1279	CLIP-seq
MIRT1273420	hsa-miR-1283	CLIP-seq
MIRT1273421	hsa-miR-1298	CLIP-seq
MIRT1273422	hsa-miR-1301	CLIP-seq
MIRT1273423	hsa-miR-1305	CLIP-seq
MIRT1273424	hsa-miR-1321	CLIP-seq
MIRT1273425	hsa-miR-1343	CLIP-seq
MIRT1273426	hsa-miR-135a	CLIP-seq
MIRT1273427	hsa-miR-135b	CLIP-seq
MIRT1273428	hsa-miR-138	CLIP-seq
MIRT1273429	hsa-miR-17	CLIP-seq
MIRT1273430	hsa-miR-1825	CLIP-seq
MIRT1273431	hsa-miR-186	CLIP-seq
MIRT1273432	hsa-miR-196a	CLIP-seq
MIRT1273433	hsa-miR-196b	CLIP-seq
MIRT1273434	hsa-miR-1976	CLIP-seq
MIRT1273435	hsa-miR-199a-5p	CLIP-seq
MIRT1273436	hsa-miR-199b-5p	CLIP-seq
MIRT1273437	hsa-miR-20a	CLIP-seq
MIRT1273438	hsa-miR-20b	CLIP-seq
MIRT1273439	hsa-miR-2115	CLIP-seq
MIRT1273440	hsa-miR-221	CLIP-seq
MIRT1273441	hsa-miR-222	CLIP-seq
MIRT1273442	hsa-miR-25	CLIP-seq
MIRT1273443	hsa-miR-300	CLIP-seq
MIRT1273444	hsa-miR-3065-5p	CLIP-seq
MIRT1273445	hsa-miR-3074-5p	CLIP-seq
MIRT1273446	hsa-miR-3119	CLIP-seq
MIRT1273447	hsa-miR-3123	CLIP-seq
MIRT1273448	hsa-miR-3143	CLIP-seq
MIRT1273449	hsa-miR-3165	CLIP-seq
MIRT1273450	hsa-miR-3179	CLIP-seq
MIRT1273451	hsa-miR-3190	CLIP-seq
MIRT1273452	hsa-miR-32	CLIP-seq
MIRT1273453	hsa-miR-3202	CLIP-seq
MIRT1273454	hsa-miR-3607-3p	CLIP-seq
MIRT1273455	hsa-miR-3609	CLIP-seq
MIRT1273456	hsa-miR-3613-3p	CLIP-seq
MIRT1273457	hsa-miR-361-3p	CLIP-seq
MIRT1273458	hsa-miR-3617	CLIP-seq
MIRT1273459	hsa-miR-363	CLIP-seq
MIRT1273460	hsa-miR-367	CLIP-seq
MIRT1273461	hsa-miR-3690	CLIP-seq
MIRT1273462	hsa-miR-3714	CLIP-seq
MIRT1273463	hsa-miR-381	CLIP-seq
MIRT1273464	hsa-miR-3925-3p	CLIP-seq
MIRT1273465	hsa-miR-3925-5p	CLIP-seq
MIRT1273466	hsa-miR-3940-5p	CLIP-seq
MIRT1273467	hsa-miR-3977	CLIP-seq
MIRT1273468	hsa-miR-4251	CLIP-seq
MIRT1273469	hsa-miR-4254	CLIP-seq
MIRT1273470	hsa-miR-4268	CLIP-seq
MIRT1273471	hsa-miR-4273	CLIP-seq
MIRT1273472	hsa-miR-4279	CLIP-seq
MIRT1273473	hsa-miR-4324	CLIP-seq
MIRT1273474	hsa-miR-4436b-5p	CLIP-seq
MIRT1273475	hsa-miR-4448	CLIP-seq
MIRT1273476	hsa-miR-4456	CLIP-seq
MIRT1273477	hsa-miR-4476	CLIP-seq
MIRT1273478	hsa-miR-4507	CLIP-seq
MIRT1273479	hsa-miR-4509	CLIP-seq
MIRT1273480	hsa-miR-451b	CLIP-seq
MIRT1273481	hsa-miR-4528	CLIP-seq
MIRT1273482	hsa-miR-4533	CLIP-seq
MIRT1273483	hsa-miR-4646-5p	CLIP-seq
MIRT1273484	hsa-miR-4654	CLIP-seq
MIRT1273485	hsa-miR-4660	CLIP-seq
MIRT1273486	hsa-miR-4677-3p	CLIP-seq
MIRT1273487	hsa-miR-4677-5p	CLIP-seq
MIRT1273488	hsa-miR-4679	CLIP-seq
MIRT1273489	hsa-miR-4687-3p	CLIP-seq
MIRT1273490	hsa-miR-4696	CLIP-seq
MIRT1273491	hsa-miR-4698	CLIP-seq
MIRT1273492	hsa-miR-4728-5p	CLIP-seq
MIRT1273493	hsa-miR-4736	CLIP-seq
MIRT1273494	hsa-miR-4739	CLIP-seq
MIRT1273495	hsa-miR-4747-5p	CLIP-seq
MIRT1273496	hsa-miR-4751	CLIP-seq
MIRT1273497	hsa-miR-4756-5p	CLIP-seq
MIRT1273498	hsa-miR-4764-3p	CLIP-seq
MIRT1273499	hsa-miR-4768-5p	CLIP-seq
MIRT1273500	hsa-miR-4769-5p	CLIP-seq
MIRT1273501	hsa-miR-4778-5p	CLIP-seq
MIRT1273502	hsa-miR-4796-3p	CLIP-seq
MIRT1273503	hsa-miR-4803	CLIP-seq
MIRT1273504	hsa-miR-495	CLIP-seq
MIRT1273505	hsa-miR-5047	CLIP-seq
MIRT1273506	hsa-miR-505	CLIP-seq
MIRT1273507	hsa-miR-508-5p	CLIP-seq
MIRT1273508	hsa-miR-516a-3p	CLIP-seq
MIRT1273509	hsa-miR-519d	CLIP-seq
MIRT1273510	hsa-miR-539	CLIP-seq
MIRT1273511	hsa-miR-544	CLIP-seq
MIRT1273512	hsa-miR-544b	CLIP-seq
MIRT1273513	hsa-miR-548a-3p	CLIP-seq
MIRT1273514	hsa-miR-548a-5p	CLIP-seq
MIRT1273515	hsa-miR-548ab	CLIP-seq
MIRT1273516	hsa-miR-548ae	CLIP-seq
MIRT1273517	hsa-miR-548ag	CLIP-seq
MIRT1273518	hsa-miR-548ah	CLIP-seq
MIRT1273519	hsa-miR-548ai	CLIP-seq
MIRT1273520	hsa-miR-548aj	CLIP-seq
MIRT1273521	hsa-miR-548ak	CLIP-seq
MIRT1273522	hsa-miR-548am	CLIP-seq
MIRT1273523	hsa-miR-548an	CLIP-seq
MIRT1273524	hsa-miR-548b-5p	CLIP-seq
MIRT1273525	hsa-miR-548c-5p	CLIP-seq
MIRT1273526	hsa-miR-548d-5p	CLIP-seq
MIRT1273527	hsa-miR-548e	CLIP-seq
MIRT1273528	hsa-miR-548f	CLIP-seq
MIRT1273529	hsa-miR-548h	CLIP-seq
MIRT1273530	hsa-miR-548i	CLIP-seq
MIRT1273531	hsa-miR-548j	CLIP-seq
MIRT1273532	hsa-miR-548v	CLIP-seq
MIRT1273533	hsa-miR-548w	CLIP-seq
MIRT1273534	hsa-miR-548x	CLIP-seq
MIRT1273535	hsa-miR-548y	CLIP-seq
MIRT1273536	hsa-miR-559	CLIP-seq
MIRT1273537	hsa-miR-580	CLIP-seq
MIRT1273538	hsa-miR-582-5p	CLIP-seq
MIRT1273539	hsa-miR-583	CLIP-seq
MIRT1273540	hsa-miR-607	CLIP-seq
MIRT1273541	hsa-miR-609	CLIP-seq
MIRT1273542	hsa-miR-624	CLIP-seq
MIRT1273543	hsa-miR-629	CLIP-seq
MIRT1273544	hsa-miR-635	CLIP-seq
MIRT1273545	hsa-miR-639	CLIP-seq
MIRT1273546	hsa-miR-641	CLIP-seq
MIRT1273547	hsa-miR-7	CLIP-seq
MIRT1273548	hsa-miR-720	CLIP-seq
MIRT1273549	hsa-miR-891b	CLIP-seq
MIRT1273550	hsa-miR-92a	CLIP-seq
MIRT1273551	hsa-miR-92b	CLIP-seq
MIRT1273552	hsa-miR-93	CLIP-seq
MIRT1273553	hsa-miR-940	CLIP-seq
MIRT1273410	hsa-miR-106a	CLIP-seq
MIRT1273411	hsa-miR-106b	CLIP-seq
MIRT1273419	hsa-miR-1279	CLIP-seq
MIRT1273421	hsa-miR-1298	CLIP-seq
MIRT1273425	hsa-miR-1343	CLIP-seq
MIRT1273429	hsa-miR-17	CLIP-seq
MIRT1273434	hsa-miR-1976	CLIP-seq
MIRT1273437	hsa-miR-20a	CLIP-seq
MIRT1273438	hsa-miR-20b	CLIP-seq
MIRT1273442	hsa-miR-25	CLIP-seq
MIRT1273450	hsa-miR-3179	CLIP-seq
MIRT1273452	hsa-miR-32	CLIP-seq
MIRT1273455	hsa-miR-3609	CLIP-seq
MIRT1273459	hsa-miR-363	CLIP-seq
MIRT1273460	hsa-miR-367	CLIP-seq
MIRT1273467	hsa-miR-3977	CLIP-seq
MIRT1273483	hsa-miR-4646-5p	CLIP-seq
MIRT1273484	hsa-miR-4654	CLIP-seq
MIRT1273495	hsa-miR-4747-5p	CLIP-seq
MIRT1273499	hsa-miR-4768-5p	CLIP-seq
MIRT1273500	hsa-miR-4769-5p	CLIP-seq
MIRT1273502	hsa-miR-4796-3p	CLIP-seq
MIRT1273509	hsa-miR-519d	CLIP-seq
MIRT1273518	hsa-miR-548ah	CLIP-seq
MIRT1273547	hsa-miR-7	CLIP-seq
MIRT1273549	hsa-miR-891b	CLIP-seq
MIRT1273550	hsa-miR-92a	CLIP-seq
MIRT1273551	hsa-miR-92b	CLIP-seq
MIRT1273552	hsa-miR-93	CLIP-seq
MIRT1273412	hsa-miR-1197	CLIP-seq
MIRT1273414	hsa-miR-1224-5p	CLIP-seq
MIRT1273416	hsa-miR-1238	CLIP-seq
MIRT2080422	hsa-miR-1261	CLIP-seq
MIRT1273418	hsa-miR-1273	CLIP-seq
MIRT1273420	hsa-miR-1283	CLIP-seq
MIRT1273421	hsa-miR-1298	CLIP-seq
MIRT2080423	hsa-miR-1322	CLIP-seq
MIRT1273426	hsa-miR-135a	CLIP-seq
MIRT1273427	hsa-miR-135b	CLIP-seq
MIRT1273428	hsa-miR-138	CLIP-seq
MIRT2080424	hsa-miR-139-5p	CLIP-seq
MIRT2080425	hsa-miR-145	CLIP-seq
MIRT1273430	hsa-miR-1825	CLIP-seq
MIRT1273431	hsa-miR-186	CLIP-seq
MIRT1273435	hsa-miR-199a-5p	CLIP-seq
MIRT1273436	hsa-miR-199b-5p	CLIP-seq
MIRT2080426	hsa-miR-2116	CLIP-seq
MIRT1273440	hsa-miR-221	CLIP-seq
MIRT1273441	hsa-miR-222	CLIP-seq
MIRT2080427	hsa-miR-23a	CLIP-seq
MIRT2080428	hsa-miR-23b	CLIP-seq
MIRT2080429	hsa-miR-23c	CLIP-seq
MIRT1273443	hsa-miR-300	CLIP-seq
MIRT1273446	hsa-miR-3119	CLIP-seq
MIRT1273447	hsa-miR-3123	CLIP-seq
MIRT1273448	hsa-miR-3143	CLIP-seq
MIRT1273449	hsa-miR-3165	CLIP-seq
MIRT2080430	hsa-miR-3187-3p	CLIP-seq
MIRT1273451	hsa-miR-3190	CLIP-seq
MIRT1273453	hsa-miR-3202	CLIP-seq
MIRT2080431	hsa-miR-3529	CLIP-seq
MIRT1273454	hsa-miR-3607-3p	CLIP-seq
MIRT1273456	hsa-miR-3613-3p	CLIP-seq
MIRT1273458	hsa-miR-3617	CLIP-seq
MIRT1273462	hsa-miR-3714	CLIP-seq
MIRT2080432	hsa-miR-379	CLIP-seq
MIRT1273463	hsa-miR-381	CLIP-seq
MIRT1273464	hsa-miR-3925-3p	CLIP-seq
MIRT1273465	hsa-miR-3925-5p	CLIP-seq
MIRT1273467	hsa-miR-3977	CLIP-seq
MIRT1273471	hsa-miR-4273	CLIP-seq
MIRT2080433	hsa-miR-433	CLIP-seq
MIRT2080434	hsa-miR-4426	CLIP-seq
MIRT2080435	hsa-miR-4435	CLIP-seq
MIRT2080436	hsa-miR-4451	CLIP-seq
MIRT1273476	hsa-miR-4456	CLIP-seq
MIRT1273480	hsa-miR-451b	CLIP-seq
MIRT2080437	hsa-miR-4529-5p	CLIP-seq
MIRT1273482	hsa-miR-4533	CLIP-seq
MIRT2080438	hsa-miR-4647	CLIP-seq
MIRT2080439	hsa-miR-4650-3p	CLIP-seq
MIRT2080440	hsa-miR-4662b	CLIP-seq
MIRT1273486	hsa-miR-4677-3p	CLIP-seq
MIRT1273487	hsa-miR-4677-5p	CLIP-seq
MIRT1273488	hsa-miR-4679	CLIP-seq
MIRT1273489	hsa-miR-4687-3p	CLIP-seq
MIRT1273490	hsa-miR-4696	CLIP-seq
MIRT2080441	hsa-miR-4701-5p	CLIP-seq
MIRT2080442	hsa-miR-4720-3p	CLIP-seq
MIRT1273493	hsa-miR-4736	CLIP-seq
MIRT1273496	hsa-miR-4751	CLIP-seq
MIRT1273498	hsa-miR-4764-3p	CLIP-seq
MIRT1273501	hsa-miR-4778-5p	CLIP-seq
MIRT2080443	hsa-miR-4782-5p	CLIP-seq
MIRT1273503	hsa-miR-4803	CLIP-seq
MIRT2080444	hsa-miR-4804-3p	CLIP-seq
MIRT1273506	hsa-miR-505	CLIP-seq
MIRT1273507	hsa-miR-508-5p	CLIP-seq
MIRT1273510	hsa-miR-539	CLIP-seq
MIRT1273514	hsa-miR-548a-5p	CLIP-seq
MIRT1273515	hsa-miR-548ab	CLIP-seq
MIRT1273521	hsa-miR-548ak	CLIP-seq
MIRT1273523	hsa-miR-548an	CLIP-seq
MIRT1273524	hsa-miR-548b-5p	CLIP-seq
MIRT1273525	hsa-miR-548c-5p	CLIP-seq
MIRT1273526	hsa-miR-548d-5p	CLIP-seq
MIRT1273529	hsa-miR-548h	CLIP-seq
MIRT1273530	hsa-miR-548i	CLIP-seq
MIRT1273531	hsa-miR-548j	CLIP-seq
MIRT2080445	hsa-miR-548s	CLIP-seq
MIRT1273532	hsa-miR-548v	CLIP-seq
MIRT1273533	hsa-miR-548w	CLIP-seq
MIRT1273535	hsa-miR-548y	CLIP-seq
MIRT2080446	hsa-miR-551a	CLIP-seq
MIRT2080447	hsa-miR-551b	CLIP-seq
MIRT1273536	hsa-miR-559	CLIP-seq
MIRT1273539	hsa-miR-583	CLIP-seq
MIRT2080448	hsa-miR-588	CLIP-seq
MIRT2080449	hsa-miR-622	CLIP-seq
MIRT1273542	hsa-miR-624	CLIP-seq
MIRT1273545	hsa-miR-639	CLIP-seq
MIRT1273546	hsa-miR-641	CLIP-seq
MIRT1273548	hsa-miR-720	CLIP-seq
MIRT1273553	hsa-miR-940	CLIP-seq
MIRT1273410	hsa-miR-106a	CLIP-seq
MIRT1273411	hsa-miR-106b	CLIP-seq
MIRT1273412	hsa-miR-1197	CLIP-seq
MIRT1273414	hsa-miR-1224-5p	CLIP-seq
MIRT1273415	hsa-miR-1236	CLIP-seq
MIRT1273416	hsa-miR-1238	CLIP-seq
MIRT2080422	hsa-miR-1261	CLIP-seq
MIRT1273419	hsa-miR-1279	CLIP-seq
MIRT1273420	hsa-miR-1283	CLIP-seq
MIRT2306589	hsa-miR-1290	CLIP-seq
MIRT1273421	hsa-miR-1298	CLIP-seq
MIRT1273422	hsa-miR-1301	CLIP-seq
MIRT1273425	hsa-miR-1343	CLIP-seq
MIRT1273426	hsa-miR-135a	CLIP-seq
MIRT1273427	hsa-miR-135b	CLIP-seq
MIRT1273428	hsa-miR-138	CLIP-seq
MIRT2080424	hsa-miR-139-5p	CLIP-seq
MIRT2080425	hsa-miR-145	CLIP-seq
MIRT1273429	hsa-miR-17	CLIP-seq
MIRT1273430	hsa-miR-1825	CLIP-seq
MIRT1273432	hsa-miR-196a	CLIP-seq
MIRT1273433	hsa-miR-196b	CLIP-seq
MIRT1273434	hsa-miR-1976	CLIP-seq
MIRT1273435	hsa-miR-199a-5p	CLIP-seq
MIRT1273436	hsa-miR-199b-5p	CLIP-seq
MIRT1273437	hsa-miR-20a	CLIP-seq
MIRT1273438	hsa-miR-20b	CLIP-seq
MIRT1273439	hsa-miR-2115	CLIP-seq
MIRT1273440	hsa-miR-221	CLIP-seq
MIRT1273441	hsa-miR-222	CLIP-seq
MIRT2080427	hsa-miR-23a	CLIP-seq
MIRT2080428	hsa-miR-23b	CLIP-seq
MIRT2080429	hsa-miR-23c	CLIP-seq
MIRT1273442	hsa-miR-25	CLIP-seq
MIRT2306590	hsa-miR-2681	CLIP-seq
MIRT1273443	hsa-miR-300	CLIP-seq
MIRT1273446	hsa-miR-3119	CLIP-seq
MIRT1273448	hsa-miR-3143	CLIP-seq
MIRT1273449	hsa-miR-3165	CLIP-seq
MIRT2306591	hsa-miR-3167	CLIP-seq
MIRT1273450	hsa-miR-3179	CLIP-seq
MIRT2080430	hsa-miR-3187-3p	CLIP-seq
MIRT1273451	hsa-miR-3190	CLIP-seq
MIRT1273452	hsa-miR-32	CLIP-seq
MIRT1273453	hsa-miR-3202	CLIP-seq
MIRT2080431	hsa-miR-3529	CLIP-seq
MIRT1273454	hsa-miR-3607-3p	CLIP-seq
MIRT1273455	hsa-miR-3609	CLIP-seq
MIRT1273456	hsa-miR-3613-3p	CLIP-seq
MIRT1273458	hsa-miR-3617	CLIP-seq
MIRT1273459	hsa-miR-363	CLIP-seq
MIRT1273460	hsa-miR-367	CLIP-seq
MIRT1273462	hsa-miR-3714	CLIP-seq
MIRT2080432	hsa-miR-379	CLIP-seq
MIRT1273463	hsa-miR-381	CLIP-seq
MIRT1273464	hsa-miR-3925-3p	CLIP-seq
MIRT2306592	hsa-miR-3973	CLIP-seq
MIRT1273467	hsa-miR-3977	CLIP-seq
MIRT1273472	hsa-miR-4279	CLIP-seq
MIRT2080433	hsa-miR-433	CLIP-seq
MIRT2080434	hsa-miR-4426	CLIP-seq
MIRT2306593	hsa-miR-4427	CLIP-seq
MIRT2080435	hsa-miR-4435	CLIP-seq
MIRT1273474	hsa-miR-4436b-5p	CLIP-seq
MIRT2306594	hsa-miR-4446-3p	CLIP-seq
MIRT1273476	hsa-miR-4456	CLIP-seq
MIRT1273477	hsa-miR-4476	CLIP-seq
MIRT1273481	hsa-miR-4528	CLIP-seq
MIRT2080437	hsa-miR-4529-5p	CLIP-seq
MIRT1273482	hsa-miR-4533	CLIP-seq
MIRT1273483	hsa-miR-4646-5p	CLIP-seq
MIRT2080438	hsa-miR-4647	CLIP-seq
MIRT1273484	hsa-miR-4654	CLIP-seq
MIRT1273485	hsa-miR-4660	CLIP-seq
MIRT2080440	hsa-miR-4662b	CLIP-seq
MIRT2306595	hsa-miR-4675	CLIP-seq
MIRT1273486	hsa-miR-4677-3p	CLIP-seq
MIRT1273488	hsa-miR-4679	CLIP-seq
MIRT2306596	hsa-miR-4680-3p	CLIP-seq
MIRT1273489	hsa-miR-4687-3p	CLIP-seq
MIRT1273491	hsa-miR-4698	CLIP-seq
MIRT2080441	hsa-miR-4701-5p	CLIP-seq
MIRT2306597	hsa-miR-4703-3p	CLIP-seq
MIRT1273493	hsa-miR-4736	CLIP-seq
MIRT2306598	hsa-miR-4741	CLIP-seq
MIRT1273495	hsa-miR-4747-5p	CLIP-seq
MIRT1273496	hsa-miR-4751	CLIP-seq
MIRT2306599	hsa-miR-4762-3p	CLIP-seq
MIRT1273498	hsa-miR-4764-3p	CLIP-seq
MIRT1273499	hsa-miR-4768-5p	CLIP-seq
MIRT1273500	hsa-miR-4769-5p	CLIP-seq
MIRT1273501	hsa-miR-4778-5p	CLIP-seq
MIRT2080443	hsa-miR-4782-5p	CLIP-seq
MIRT1273502	hsa-miR-4796-3p	CLIP-seq
MIRT1273504	hsa-miR-495	CLIP-seq
MIRT1273505	hsa-miR-5047	CLIP-seq
MIRT1273506	hsa-miR-505	CLIP-seq
MIRT1273507	hsa-miR-508-5p	CLIP-seq
MIRT1273508	hsa-miR-516a-3p	CLIP-seq
MIRT1273509	hsa-miR-519d	CLIP-seq
MIRT2306600	hsa-miR-520g	CLIP-seq
MIRT2306601	hsa-miR-520h	CLIP-seq
MIRT1273510	hsa-miR-539	CLIP-seq
MIRT1273511	hsa-miR-544	CLIP-seq
MIRT1273513	hsa-miR-548a-3p	CLIP-seq
MIRT1273514	hsa-miR-548a-5p	CLIP-seq
MIRT1273515	hsa-miR-548ab	CLIP-seq
MIRT1273516	hsa-miR-548ae	CLIP-seq
MIRT1273517	hsa-miR-548ag	CLIP-seq
MIRT1273518	hsa-miR-548ah	CLIP-seq
MIRT1273519	hsa-miR-548ai	CLIP-seq
MIRT1273520	hsa-miR-548aj	CLIP-seq
MIRT1273521	hsa-miR-548ak	CLIP-seq
MIRT1273522	hsa-miR-548am	CLIP-seq
MIRT1273523	hsa-miR-548an	CLIP-seq
MIRT1273524	hsa-miR-548b-5p	CLIP-seq
MIRT1273525	hsa-miR-548c-5p	CLIP-seq
MIRT1273526	hsa-miR-548d-5p	CLIP-seq
MIRT1273527	hsa-miR-548e	CLIP-seq
MIRT1273528	hsa-miR-548f	CLIP-seq
MIRT1273529	hsa-miR-548h	CLIP-seq
MIRT1273530	hsa-miR-548i	CLIP-seq
MIRT1273531	hsa-miR-548j	CLIP-seq
MIRT2080445	hsa-miR-548s	CLIP-seq
MIRT1273532	hsa-miR-548v	CLIP-seq
MIRT1273533	hsa-miR-548w	CLIP-seq
MIRT1273534	hsa-miR-548x	CLIP-seq
MIRT1273535	hsa-miR-548y	CLIP-seq
MIRT2080446	hsa-miR-551a	CLIP-seq
MIRT2080447	hsa-miR-551b	CLIP-seq
MIRT1273536	hsa-miR-559	CLIP-seq
MIRT1273538	hsa-miR-582-5p	CLIP-seq
MIRT2080448	hsa-miR-588	CLIP-seq
MIRT1273541	hsa-miR-609	CLIP-seq
MIRT2080449	hsa-miR-622	CLIP-seq
MIRT1273542	hsa-miR-624	CLIP-seq
MIRT1273545	hsa-miR-639	CLIP-seq
MIRT1273546	hsa-miR-641	CLIP-seq
MIRT1273547	hsa-miR-7	CLIP-seq
MIRT1273548	hsa-miR-720	CLIP-seq
MIRT2306602	hsa-miR-876-5p	CLIP-seq
MIRT1273549	hsa-miR-891b	CLIP-seq
MIRT1273550	hsa-miR-92a	CLIP-seq
MIRT1273551	hsa-miR-92b	CLIP-seq
MIRT1273552	hsa-miR-93	CLIP-seq
MIRT1273553	hsa-miR-940	CLIP-seq
MIRT1273412	hsa-miR-1197	CLIP-seq
MIRT1273414	hsa-miR-1224-5p	CLIP-seq
MIRT1273416	hsa-miR-1238	CLIP-seq
MIRT1273428	hsa-miR-138	CLIP-seq
MIRT1273447	hsa-miR-3123	CLIP-seq
MIRT1273449	hsa-miR-3165	CLIP-seq
MIRT1273451	hsa-miR-3190	CLIP-seq
MIRT1273453	hsa-miR-3202	CLIP-seq
MIRT1273458	hsa-miR-3617	CLIP-seq
MIRT1273465	hsa-miR-3925-5p	CLIP-seq
MIRT1273476	hsa-miR-4456	CLIP-seq
MIRT1273482	hsa-miR-4533	CLIP-seq
MIRT1273496	hsa-miR-4751	CLIP-seq
MIRT1273514	hsa-miR-548a-5p	CLIP-seq
MIRT1273515	hsa-miR-548ab	CLIP-seq
MIRT1273521	hsa-miR-548ak	CLIP-seq
MIRT1273524	hsa-miR-548b-5p	CLIP-seq
MIRT1273525	hsa-miR-548c-5p	CLIP-seq
MIRT1273526	hsa-miR-548d-5p	CLIP-seq
MIRT1273529	hsa-miR-548h	CLIP-seq
MIRT1273530	hsa-miR-548i	CLIP-seq
MIRT1273531	hsa-miR-548j	CLIP-seq
MIRT1273533	hsa-miR-548w	CLIP-seq
MIRT1273535	hsa-miR-548y	CLIP-seq
MIRT1273536	hsa-miR-559	CLIP-seq
MIRT1273545	hsa-miR-639	CLIP-seq
MIRT1273546	hsa-miR-641	CLIP-seq
MIRT1273548	hsa-miR-720	CLIP-seq
MIRT1273413	hsa-miR-1200	CLIP-seq
MIRT1273421	hsa-miR-1298	CLIP-seq
MIRT1273424	hsa-miR-1321	CLIP-seq
MIRT2080423	hsa-miR-1322	CLIP-seq
MIRT2080424	hsa-miR-139-5p	CLIP-seq
MIRT2080426	hsa-miR-2116	CLIP-seq
MIRT2080427	hsa-miR-23a	CLIP-seq
MIRT2080428	hsa-miR-23b	CLIP-seq
MIRT2080429	hsa-miR-23c	CLIP-seq
MIRT1273444	hsa-miR-3065-5p	CLIP-seq
MIRT2080430	hsa-miR-3187-3p	CLIP-seq
MIRT1273457	hsa-miR-361-3p	CLIP-seq
MIRT1273458	hsa-miR-3617	CLIP-seq
MIRT1273462	hsa-miR-3714	CLIP-seq
MIRT1273467	hsa-miR-3977	CLIP-seq
MIRT1273468	hsa-miR-4251	CLIP-seq
MIRT1273471	hsa-miR-4273	CLIP-seq
MIRT1273473	hsa-miR-4324	CLIP-seq
MIRT2080433	hsa-miR-433	CLIP-seq
MIRT2080435	hsa-miR-4435	CLIP-seq
MIRT1273479	hsa-miR-4509	CLIP-seq
MIRT1273481	hsa-miR-4528	CLIP-seq
MIRT2080437	hsa-miR-4529-5p	CLIP-seq
MIRT1273486	hsa-miR-4677-3p	CLIP-seq
MIRT1273487	hsa-miR-4677-5p	CLIP-seq
MIRT1273488	hsa-miR-4679	CLIP-seq
MIRT2080441	hsa-miR-4701-5p	CLIP-seq
MIRT2080442	hsa-miR-4720-3p	CLIP-seq
MIRT1273492	hsa-miR-4728-5p	CLIP-seq
MIRT1273493	hsa-miR-4736	CLIP-seq
MIRT1273494	hsa-miR-4739	CLIP-seq
MIRT1273497	hsa-miR-4756-5p	CLIP-seq
MIRT2604306	hsa-miR-4775	CLIP-seq
MIRT1273501	hsa-miR-4778-5p	CLIP-seq
MIRT1273503	hsa-miR-4803	CLIP-seq
MIRT2080444	hsa-miR-4804-3p	CLIP-seq
MIRT1273504	hsa-miR-495	CLIP-seq
MIRT1273512	hsa-miR-544b	CLIP-seq
MIRT1273514	hsa-miR-548a-5p	CLIP-seq
MIRT1273515	hsa-miR-548ab	CLIP-seq
MIRT1273521	hsa-miR-548ak	CLIP-seq
MIRT1273523	hsa-miR-548an	CLIP-seq
MIRT1273524	hsa-miR-548b-5p	CLIP-seq
MIRT1273525	hsa-miR-548c-5p	CLIP-seq
MIRT1273526	hsa-miR-548d-5p	CLIP-seq
MIRT1273529	hsa-miR-548h	CLIP-seq
MIRT1273530	hsa-miR-548i	CLIP-seq
MIRT1273531	hsa-miR-548j	CLIP-seq
MIRT2080445	hsa-miR-548s	CLIP-seq
MIRT1273533	hsa-miR-548w	CLIP-seq
MIRT1273535	hsa-miR-548y	CLIP-seq
MIRT2080446	hsa-miR-551a	CLIP-seq
MIRT2080447	hsa-miR-551b	CLIP-seq
MIRT1273536	hsa-miR-559	CLIP-seq
MIRT1273537	hsa-miR-580	CLIP-seq
MIRT1273538	hsa-miR-582-5p	CLIP-seq
MIRT2080448	hsa-miR-588	CLIP-seq
MIRT2604307	hsa-miR-590-3p	CLIP-seq
MIRT1273546	hsa-miR-641	CLIP-seq
MIRT1273553	hsa-miR-940	CLIP-seq
MIRT1273413	hsa-miR-1200	CLIP-seq
MIRT1273423	hsa-miR-1305	CLIP-seq
MIRT1273424	hsa-miR-1321	CLIP-seq
MIRT2080424	hsa-miR-139-5p	CLIP-seq
MIRT2080426	hsa-miR-2116	CLIP-seq
MIRT2080427	hsa-miR-23a	CLIP-seq
MIRT2080428	hsa-miR-23b	CLIP-seq
MIRT2080429	hsa-miR-23c	CLIP-seq
MIRT1273444	hsa-miR-3065-5p	CLIP-seq
MIRT2080430	hsa-miR-3187-3p	CLIP-seq
MIRT1273457	hsa-miR-361-3p	CLIP-seq
MIRT1273458	hsa-miR-3617	CLIP-seq
MIRT1273467	hsa-miR-3977	CLIP-seq
MIRT1273468	hsa-miR-4251	CLIP-seq
MIRT1273471	hsa-miR-4273	CLIP-seq
MIRT1273473	hsa-miR-4324	CLIP-seq
MIRT2080433	hsa-miR-433	CLIP-seq
MIRT2080435	hsa-miR-4435	CLIP-seq
MIRT1273479	hsa-miR-4509	CLIP-seq
MIRT1273481	hsa-miR-4528	CLIP-seq
MIRT2080437	hsa-miR-4529-5p	CLIP-seq
MIRT1273486	hsa-miR-4677-3p	CLIP-seq
MIRT1273487	hsa-miR-4677-5p	CLIP-seq
MIRT1273488	hsa-miR-4679	CLIP-seq
MIRT1273491	hsa-miR-4698	CLIP-seq
MIRT2080441	hsa-miR-4701-5p	CLIP-seq
MIRT1273492	hsa-miR-4728-5p	CLIP-seq
MIRT1273494	hsa-miR-4739	CLIP-seq
MIRT1273497	hsa-miR-4756-5p	CLIP-seq
MIRT1273501	hsa-miR-4778-5p	CLIP-seq
MIRT1273503	hsa-miR-4803	CLIP-seq
MIRT1273504	hsa-miR-495	CLIP-seq
MIRT1273512	hsa-miR-544b	CLIP-seq
MIRT2080445	hsa-miR-548s	CLIP-seq
MIRT2080446	hsa-miR-551a	CLIP-seq
MIRT2080447	hsa-miR-551b	CLIP-seq
MIRT1273537	hsa-miR-580	CLIP-seq
MIRT1273538	hsa-miR-582-5p	CLIP-seq
MIRT2080448	hsa-miR-588	CLIP-seq
MIRT1273540	hsa-miR-607	CLIP-seq
MIRT1273546	hsa-miR-641	CLIP-seq

104

Show/Hide all (104)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	TAS	20552554
GO:0001725	Component	Stress fiber	IDA	24036928
GO:0001890	Process	Placenta development	TAS	20552554
GO:0001932	Process	Regulation of protein phosphorylation	IGI	19913511
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	15166238
GO:0001952	Process	Regulation of cell-matrix adhesion	IEA
GO:0003007	Process	Heart morphogenesis	TAS	20552554
GO:0003779	Function	Actin binding	IDA	16803572
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	EXP	12235133, 12391143, 14676198
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	ISS
GO:0004713	Function	Protein tyrosine kinase activity	TAS
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	10655584, 11331870
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IMP	9360983
GO:0005178	Function	Integrin binding	IPI	26763945
GO:0005515	Function	Protein binding	IPI	7561682, 7597091, 8649368, 9285683, 9756887, 9786953, 10655584, 10822899, 11331870, 14688263, 15657067, 15855171, 16291744, 16354697, 16803572, 16966330, 17525734, 18256281, 18497331, 18560762, 18835089, 19494199, 19732724, 19857493, 19917054, 20473329, 20576130, 21034468, 21266176
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	15855171
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA	15855171
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	TAS	10801330
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	IBA
GO:0005925	Component	Focal adhesion	IDA	10655584, 15855171, 23574715
GO:0005925	Component	Focal adhesion	IEA
GO:0005929	Component	Cilium	IDA
GO:0005938	Component	Cell cortex	IEA
GO:0007172	Process	Signal complex assembly	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	24036928
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	24036928
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	11331870
GO:0007229	Process	Integrin-mediated signaling pathway	TAS	9636140, 15725728
GO:0007411	Process	Axon guidance	TAS	15725728
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0008360	Process	Regulation of cell shape	IEA
GO:0008360	Process	Regulation of cell shape	IMP	10655584, 15166238
GO:0008432	Function	JUN kinase binding	IDA	10925297
GO:0010594	Process	Regulation of endothelial cell migration	TAS	20552554
GO:0010632	Process	Regulation of epithelial cell migration	IGI	19913511
GO:0010634	Process	Positive regulation of epithelial cell migration	IGI	26944318
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IGI	26944318
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IGI	26754294
GO:0010763	Process	Positive regulation of fibroblast migration	IDA	26763945
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	IMP	20305651, 26934001
GO:0016740	Function	Transferase activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	10655584, 11331870
GO:0019901	Function	Protein kinase binding	IPI	19118217
GO:0019903	Function	Protein phosphatase binding	IPI	28759036
GO:0022408	Process	Negative regulation of cell-cell adhesion	IDA	21703394
GO:0030010	Process	Establishment of cell polarity	TAS	19525103
GO:0030154	Process	Cell differentiation	IEA
GO:0030155	Process	Regulation of cell adhesion	IBA
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IDA	11331870, 21703394
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	IDA	10655584
GO:0035995	Process	Detection of muscle stretch	TAS	30568254
GO:0036064	Component	Ciliary basal body	IDA	31630787
GO:0038007	Process	Netrin-activated signaling pathway	TAS	15725728
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0042127	Process	Regulation of cell population proliferation	IMP	18206965
GO:0042169	Function	SH2 domain binding	IPI	15077193
GO:0042995	Component	Cell projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	15166238
GO:0043087	Process	Regulation of GTPase activity	TAS	19525103
GO:0045595	Process	Regulation of cell differentiation	IEA
GO:0045667	Process	Regulation of osteoblast differentiation	IMP	16927379
GO:0045860	Process	Positive regulation of protein kinase activity	IMP	11331870
GO:0046777	Process	Protein autophosphorylation	IDA	10655584, 11331870
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0048013	Process	Ephrin receptor signaling pathway	IDA	10655584
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048870	Process	Cell motility	TAS	15725728
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0051493	Process	Regulation of cytoskeleton organization	TAS	15725728
GO:0051893	Process	Regulation of focal adhesion assembly	IGI	19913511
GO:0051893	Process	Regulation of focal adhesion assembly	TAS	16919435, 19525103
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IGI	26944318
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	15166238
GO:0060396	Process	Growth hormone receptor signaling pathway	IDA	10925297
GO:0070161	Component	Anchoring junction	IEA
GO:0090303	Process	Positive regulation of wound healing	IDA	26763945
GO:0097706	Process	Vascular endothelial cell response to oscillatory fluid shear stress	TAS
GO:0120041	Process	Positive regulation of macrophage proliferation	IGI	26754294
GO:0140677	Function	Molecular function activator activity	EXP	12467573
GO:1900024	Process	Regulation of substrate adhesion-dependent cell spreading	IGI	19913511
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	ISS
GO:2000811	Process	Negative regulation of anoikis	IMP	22402981

MIM	HGNC	e!Ensembl
600758	9611	ENSG00000169398

Q05397

Protein name

Focal adhesion kinase 1 (FADK 1) (EC 2.7.10.2) (Focal adhesion kinase-related nonkinase) (FRNK) (Protein phosphatase 1 regulatory subunit 71) (PPP1R71) (Protein-tyrosine kinase 2) (p125FAK) (pp125FAK)

Protein function

Non-receptor protein-tyrosine kinase that plays an essential role in regulating cell migration, adhesion, spreading, reorganization of the actin cytoskeleton, formation and disassembly of focal adhesions and cell protrusions, cell cycle progress

PDB

1K04 , 1K05 , 1MP8 , 1OW6 , 1OW7 , 1OW8 , 2ETM , 2IJM , 3B71 , 3BZ3 , 3PXK , 3S9O , 4EBV , 4EBW , 4GU6 , 4GU9 , 4I4E , 4I4F , 4K8A , 4K9Y , 4KAB , 4KAO , 4NY0 , 4Q9S , 6I8Z , 6LES , 6PW8 , 6YOJ , 6YQ1 , 6YR9 , 6YT6 , 6YVS , 6YVY , 6YXV , 7PI4 , 7W7Z , 7W8B , 7W8I , 7W9U

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18038	FERM_N_2	35 → 130	FERM N-terminal domain	Domain
PF00373	FERM_M	133 → 258	FERM central domain	Domain
PF07714	PK_Tyr_Ser-Thr	422 → 676	Protein tyrosine and serine/threonine kinase	Domain
PF03623	Focal_AT	914 → 1046	Focal adhesion targeting region	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in B and T-lymphocytes. Isoform 1 and isoform 6 are detected in lung fibroblasts (at protein level). Ubiquitous. Expressed in epithelial cells (at protein level) (PubMed:31630787). {ECO:0000269|PubMed:20109444, ECO:0000269|Pub

Sequence

MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFII
RPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQE
IAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNE
GVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLA
LRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQM
LTAAHALAVDAKNLLDVIDQARLKMLGQTRPH

Sequence length

1052

Interactions

View interactions

	KEGG		Reactome
	Endocrine resistance ErbB signaling pathway Chemokine signaling pathway Efferocytosis PI3K-Akt signaling pathway Axon guidance VEGF signaling pathway Focal adhesion Leukocyte transendothelial migration Regulation of actin cytoskeleton Growth hormone synthesis, secretion and action Bacterial invasion of epithelial cells Shigellosis Yersinia infection Amoebiasis Human cytomegalovirus infection Human papillomavirus infection Human immunodeficiency virus 1 infection Pathways in cancer Transcriptional misregulation in cancer Proteoglycans in cancer Chemical carcinogenesis - reactive oxygen species Small cell lung cancer Lipid and atherosclerosis Fluid shear stress and atherosclerosis		Apoptotic cleavage of cellular proteins Regulation of actin dynamics for phagocytic cup formation Integrin signaling GRB2:SOS provides linkage to MAPK signaling for Integrins p130Cas linkage to MAPK signaling for integrins NCAM signaling for neurite out-growth EPHB-mediated forward signaling DCC mediated attractive signaling VEGFA-VEGFR2 Pathway RHO GTPases Activate WASPs and WAVEs RAF/MAP kinase cascade MET activates PTK2 signaling Extra-nuclear estrogen signaling Estrogen-dependent nuclear events downstream of ESR-membrane signaling FCGR3A-mediated phagocytosis

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Lung cancer	Uncertain significance	rs61733047	RCV005928798
Malignant tumor of esophagus	Uncertain significance	rs61733047	RCV005928797

Show/Hide Text Mining Associations (193)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Achalasia Addisonianism Alacrimia syndrome	Associate	25326692
Adenocarcinoma	Associate	31291201
Adenocarcinoma Follicular	Stimulate	15483349
Adenocarcinoma of Lung	Associate	23874428, 26556867, 26631041, 28928239, 33215807, 37311571
Adenoma	Associate	15483349
Adenomyosis	Associate	30365102
Aging Premature	Associate	35069971
Alzheimer Disease	Associate	36039594
Anophthalmia with pulmonary hypoplasia	Associate	26119934
Arterial Tortuosity Syndrome	Associate	26376865
Arthritis Rheumatoid	Associate	17963503, 23918525
Asthma	Associate	30737985
Atherosclerosis	Associate	34619327
Atrial Fibrillation	Associate	23593175
Autistic Disorder	Inhibit	21703394
Autoimmune Diseases	Associate	24227778
Bone Marrow Diseases	Associate	19604240
Brain Neoplasms	Associate	34702773
Breast Neoplasms	Associate	10047444, 10400703, 10899173, 12167618, 12659633, 14629195, 15743500, 15861214, 16136050, 16457699, 17515959, 17537730, 18383836, 19029090, 19364917 View all (48 more)
Breast Neoplasms	Stimulate	16288304
Bronchial Diseases	Associate	29749523
Calcinosis Cutis	Associate	25749031, 35022419
Carcinogenesis	Associate	12174366, 15132756, 15483349, 15861214, 20724588, 26119934, 26393679, 29777904, 36156852, 36857183
Carcinogenesis	Stimulate	31671889
Carcinoid Tumor	Associate	20407018
Carcinoma	Stimulate	15483349
Carcinoma Hepatocellular	Stimulate	18695939, 32806748
Carcinoma Hepatocellular	Associate	18948272, 18997105, 24498348, 24516351, 24912675, 25978354, 26204832, 26443539, 27145276, 28475688, 29506532, 33182805, 33589614, 34108451, 35127170 View all (5 more)
Carcinoma Hepatocellular	Inhibit	27465549
Carcinoma Medullary	Stimulate	15483349
Carcinoma Non Small Cell Lung	Associate	23154546, 25122425, 25826078, 27764812, 28076322, 31485605, 31729456, 32898818, 34363324, 34607394, 35131384, 36695419, 37919739
Carcinoma Non Small Cell Lung	Inhibit	30261900
Carcinoma Ovarian Epithelial	Stimulate	15161045
Carcinoma Ovarian Epithelial	Associate	18353772, 24655477, 31062766
Carcinoma Pancreatic Ductal	Stimulate	26119934
Carcinoma Pancreatic Ductal	Associate	26191169, 30206226, 30747824, 32580737, 32705304, 33025708, 35628269
Carcinoma Papillary	Stimulate	15483349
Carcinoma Papillary	Associate	20405349
Carcinoma Papillary Follicular	Associate	37443754
Carcinoma Renal Cell	Associate	23139422, 25805832, 27220961, 28418903, 30816490, 30975094, 31902920, 37009792
Carcinoma Renal Cell	Inhibit	34745115
Carcinoma Squamous Cell	Associate	15132756, 18349846, 34263914, 36499729
Carcinoma Squamous Cell	Stimulate	25280968
Cardiomyopathy Dilated	Stimulate	16202218
Cardiomyopathy Hypertrophic	Associate	36598836
Cholangiocarcinoma	Associate	25012246, 33507702, 34971568, 36154723
Clear cell metastatic renal cell carcinoma	Associate	36347549
Cognition Disorders	Associate	36039594
Colonic Neoplasms	Associate	16461767, 16886596, 25922072, 29135089
Colorectal Neoplasms	Associate	15750208, 16920698, 17848589, 17898132, 18805444, 21209368, 21968138, 22934709, 24946134, 25208577, 27178753, 28186967, 28492141, 28624785, 28953264 View all (18 more)
Colorectal Neoplasms	Inhibit	16920701
Colorectal Neoplasms	Stimulate	35094080
Constriction Pathologic	Associate	36696802
Corneal Endothelial Cell Loss	Associate	31059085
Corneal Injuries	Associate	34827680
Crohn Disease	Associate	29027377
Crohn Disease	Inhibit	36444838
Death	Associate	34745115
Diabetes Mellitus Type 1	Associate	33029194
Disease	Associate	12531888
Disease	Stimulate	21058027
Down Syndrome	Associate	27666924
Drug Related Side Effects and Adverse Reactions	Inhibit	16309239
Drug Related Side Effects and Adverse Reactions	Associate	20021699, 34031486
Ehlers Danlos syndrome progeroid form	Stimulate	15210734
Endometrial Neoplasms	Associate	19656390, 19823058, 21058027, 24039841, 27497669
Endometriosis	Associate	25973072
Erectile Dysfunction	Associate	30333254
Esophageal Neoplasms	Associate	16805824
Esophageal Squamous Cell Carcinoma	Associate	12838315, 19857493, 30880778, 31054987, 35428295, 35962191, 38043670, 38280862
Fibrocartilaginous embolism	Associate	30370584
Fibrosis	Associate	16202218, 32580737, 33025708, 36696802
Focal Epithelial Hyperplasia	Associate	34575938
Gastritis	Associate	36060520
Gastrointestinal Stromal Tumors	Associate	14724156, 29206199, 30149002
GATA2 Deficiency	Associate	32321919
Genital Neoplasms Female	Associate	15161045
Glioblastoma	Associate	10400703, 16251422, 23387972, 23387973, 23601662, 24599080, 27293031, 29439667, 34702773, 40564997
Glioma	Associate	24879377, 25833462, 28422726, 28990104, 37270527, 37845206
Glioma of Brain Familial	Associate	22938480
Glomerulonephritis Membranoproliferative	Associate	32580737
Glycogen Storage Disease IIIA	Associate	33107920
Growth Disorders	Associate	26119934
HAIR AN syndrome	Associate	19724156
Hashimoto Disease	Stimulate	34867951
Head and Neck Neoplasms	Associate	27036135, 37819945
Helicobacter Infections	Associate	36060520
Hepatitis C	Associate	15133472
Hepatoblastoma	Associate	29484384
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	18941742
Hereditary Breast and Ovarian Cancer Syndrome	Associate	19568240
Hyperkinesis	Associate	37137886
Hypertrophy	Associate	12531888
Hypoxia	Stimulate	23545606, 35338412
Hypoxia	Associate	25889845
Hypoxia Brain	Stimulate	26282073
Idiopathic Noncirrhotic Portal Hypertension	Associate	32806748
Idiopathic Pulmonary Fibrosis	Inhibit	20109444
Idiopathic Pulmonary Fibrosis	Associate	29144435
Idiopathic Pulmonary Fibrosis	Stimulate	38053045
Infections	Associate	20674951, 34205064
Inflammation	Associate	20943963, 24405819, 33378972, 34619327, 37554278
Intervertebral Disc Degeneration	Associate	30370584
Intestinal Neoplasms	Stimulate	18987997
LEOPARD Syndrome	Stimulate	16202218
Leukemia	Associate	26004127
Leukemia Lymphocytic Chronic B Cell	Associate	24916506
Leukemia Myeloid Acute	Associate	26785729, 34862757, 37038247
Leukemia T Cell	Associate	23047954
Liposarcoma Myxoid	Associate	29190494
Liver Cirrhosis	Associate	29786754, 30326962
Liver Neoplasms	Associate	24912675, 35127170
Lung Neoplasms	Associate	15736429, 19568240, 22178655, 25122425, 27041993, 28068967, 28350337, 28351346, 28991240, 30925742, 36209201, 37445817
Lupus Erythematosus Systemic	Associate	17469136
Lymphatic Metastasis	Stimulate	12174366, 12838315, 29665129, 36436682
Lymphatic Metastasis	Associate	33107920
Lymphoma Large B Cell Diffuse	Associate	35069971
Lymphoma Non Hodgkin	Associate	35027024
Lymphoma T Cell	Associate	24227778
Magnesium Deficiency	Inhibit	33210606
Melanoma	Associate	16552181, 16798740, 18823558, 18941742, 21360640, 22568947, 22810307, 24911159, 27855389, 28560386, 30042328, 30104528, 31140988, 35022419, 35525274, 7543052, 7615962 View all (2 more)
Melanoma	Inhibit	35525274
Meningioma	Associate	28610844, 36288512
Mesothelioma	Associate	27736841
Mesothelioma Malignant	Associate	31671889, 34638565, 35794237
Mitochondrial Diseases	Associate	36039594, 37236195
Mouth Neoplasms	Associate	32183030, 33860659
Multiple Myeloma	Associate	26282073, 26848618, 31350562, 31532704, 31948430
Myelodysplastic Syndromes	Associate	23047954
Nasopharyngeal Carcinoma	Associate	24214394, 26339346, 27170279, 33797657, 35836107
Necrosis	Inhibit	25611393
Neoplasm Metastasis	Associate	15466376, 18349846, 18695939, 18941742, 18987997, 19823058, 20159588, 20405349, 21209368, 21464589, 21800286, 22178655, 22272086, 23874428, 24092571 View all (36 more)
Neoplasm Metastasis	Inhibit	28953264, 29135089, 30261900
Neoplasms	Associate	10400703, 11346466, 12174366, 12467573, 12838315, 14629195, 15132756, 15133472, 15161045, 15466376, 15483349, 15743500, 15750208, 15855171, 16136050 View all (110 more)
Neoplasms	Stimulate	15736429, 24693876
Neoplasms	Inhibit	36849889, 7887451, 9832564
Neuroblastoma	Associate	17327229, 17828307, 19885861, 25862488, 27009842, 35272839
Neuroendocrine Tumors	Inhibit	20407018
Neuroinflammatory Diseases	Associate	36039594
NOG Related Symphalangism Spectrum Disorder	Associate	15750208
Oncogene Addiction	Associate	29133945
Organizing Pneumonia	Associate	26006016
Osteoarthritis	Associate	17963503, 30583016
Osteosarcoma	Associate	11346466, 24391455, 25550780, 26130413, 28846700, 31122179, 33969873, 34884541
Osteosarcoma	Stimulate	26393679
Ovarian Neoplasms	Associate	15161045, 16361572, 18353772, 18632638, 21643014, 23275034, 23545606, 25277212, 25886093, 26497667, 28859612, 28990249, 29700289, 30523211, 34654724 View all (4 more)
Ovarian Neoplasms	Stimulate	15466376, 24523919
Pancreatic Neoplasms	Associate	16209712, 20021699, 21464589, 22889981, 23920124, 25170871, 25268648, 26191169, 29777904, 31059194, 32272917, 32705304, 33025708, 33625109, 35628269, 36516693, 39210440 View all (2 more)
Pancreatic Neoplasms	Stimulate	38521069
Pancreatitis	Associate	33198821
Papilloma	Stimulate	15132756
Periodontal Diseases	Inhibit	37175429
Personality Disorders	Associate	23681745, 36609600
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	23047954
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	36944577
Primary Myelofibrosis	Stimulate	19604240
Prodromal Symptoms	Associate	25122425
Prostatic Neoplasms	Associate	11713275, 18922979, 20412587, 20537156, 20725143, 22378065, 24223781, 25277191, 26312765, 26799186, 28704809, 29024195, 29740048, 31929761, 32175798, 32205868, 35682554 View all (2 more)
Prostatic Neoplasms Castration Resistant	Associate	32205868, 34229670
Prostatic stromal proliferation of uncertain malignant potential	Associate	14724156
Prostatitis	Associate	17449913, 29753676
Pyruvate Carboxylase Deficiency Disease	Stimulate	38280862
Radiation Injuries	Associate	24946134
Recombinant chromosome 8 syndrome	Associate	35578198
Rectal Neoplasms	Associate	27171907
Retinal Detachment	Inhibit	25611393
Retinoblastoma	Associate	35671035
Sarcoma	Associate	22461510
Sarcoma Ewing	Associate	23681745
Small Cell Lung Carcinoma	Associate	20802517, 21800286
Small Cell Lung Carcinoma	Stimulate	30352800
Squamous Cell Carcinoma of Head and Neck	Associate	18349846, 20579373, 24565984, 26752742, 27036135, 28427180, 29970910, 31379147, 33634070, 33860659, 34031486, 34930321, 37819945
Stomach Diseases	Associate	30773850
Stomach Neoplasms	Associate	20724588, 22160140, 25741138, 26303970, 27278554, 28460635, 32951272, 32964029, 33299895, 33639150, 35471457, 35488236, 36060520, 36193075, 37256823, 37707957, 37950040 View all (2 more)
Tertiary Lymphoid Structures	Stimulate	15466376
Tertiary Lymphoid Structures	Associate	18349846
Thrombasthenia	Associate	9351872
Thrombosis	Associate	19572074, 35955827
Thyroid Cancer Papillary	Associate	15483349, 29665129, 37443754
Thyroid Diseases	Associate	20405349
Thyroid Neoplasms	Associate	15483349, 29665129
Thyroid Neoplasms	Stimulate	25277206
Tongue Neoplasms	Associate	29970910, 31023264, 32236620, 33634070
Triple Negative Breast Neoplasms	Stimulate	24693876
Triple Negative Breast Neoplasms	Associate	25304315, 25749031, 27484639, 30237308, 30728047, 31926619, 32325700, 33006750, 35429924, 37185776, 37254289, 39769120
Tuberous Sclerosis	Inhibit	24606538
Urinary Bladder Neoplasms	Associate	22353809, 26786295, 26837847, 31648990, 36436682, 37932474, 40654029
Uterine Cervical Neoplasms	Associate	14675348, 24058594, 32416888, 32604782, 35104170, 36088372, 36838908
Uterine Diseases	Associate	21058027
Uveal melanoma	Associate	36596361
Vascular Diseases	Associate	34619327
Vitamin D Deficiency	Associate	15750208
Vitreoretinopathy Proliferative	Associate	19494199

PTK2 (protein tyrosine kinase 2)