Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57468
Gene name Gene Name - the full gene name approved by the HGNC.
Solute carrier family 12 member 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLC12A5
Synonyms (NCBI Gene) Gene synonyms aliases
DEE34, EIEE34, EIG14, KCC2, hKCC2
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.12
Summary Summary of gene provided in NCBI Entrez Gene.
K-Cl cotransporters are proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential. The protein encoded by this gene is an integral membrane K-Cl cotransporter that can function in either a net efflux or infl
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs142740233 G>A,T Risk-factor, benign Missense variant, coding sequence variant
rs368484023 A>G,T Pathogenic Coding sequence variant, missense variant
rs548424453 C>A,T Risk-factor Coding sequence variant, missense variant
rs750336750 G>A,T Pathogenic Coding sequence variant, missense variant
rs863225304 T>C Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT501141 hsa-miR-3614-5p HITS-CLIP 23824327
MIRT501140 hsa-miR-6500-3p HITS-CLIP 23824327
MIRT653758 hsa-miR-6840-3p HITS-CLIP 23824327
MIRT653757 hsa-miR-4726-3p HITS-CLIP 23824327
MIRT653756 hsa-miR-6887-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0006811 Process Monoatomic ion transport IDA 12106695
GO:0006811 Process Monoatomic ion transport IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606726 13818 ENSG00000124140
Protein
UniProt ID Q9H2X9
Protein name Solute carrier family 12 member 5 (Electroneutral potassium-chloride cotransporter 2) (K-Cl cotransporter 2) (hKCC2) (Neuronal K-Cl cotransporter)
Protein function Mediates electroneutral potassium-chloride cotransport in mature neurons and is required for neuronal Cl(-) homeostasis (PubMed:12106695). As major extruder of intracellular chloride, it establishes the low neuronal Cl(-) levels required for chl
PDB 6M23 , 7D8Z
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00324 AA_permease 125 328 Amino acid permease Family
PF00324 AA_permease 412 699 Amino acid permease Family
PF03522 SLC12 711 837 Solute carrier family 12 Family
PF03522 SLC12 830 983 Solute carrier family 12 Family
PF03522 SLC12 1030 1139 Solute carrier family 12 Family
Tissue specificity TISSUE SPECIFICITY: Brain specific. Detected in neuronal cells. {ECO:0000269|PubMed:12106695}.
Sequence
MSRRFTVTSLPPAGPARSPDPESRRHSVADPRHLPGEDVKGDGNPKESSPFINSTDTEKG
KEYDGKNMALFEEEMDTSPMVSSLLSGLANYTNLPQGSREHEEAENNEGGKKKPVQAPRM
GTFMGVYLPCLQNIFGVILFLRLTWVVGIAGIMESFCMVFICCSCTMLTAISMSAIATNG
VVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLAYLFPAMAIFKAE
DASGEAAAMLNNMRVYGTCVLTCMATVVFVGVKYVNKFALVFLGCVILSILAIYAGVIKS
AFDPPNFPICLLGNRTLSRHGFDVCAKL
AWEGNETVTTRLWGLFCSSRFLNATCDEYFTR
NNVTEIQGIPGAASGLIKENLWSSYLTKGVIVERSGMTSVGLADGTPIDMDHPYVFSDMT
SYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPTGTILAIATTSAVYISSVVLFGACI
EGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDG
IVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACA
VQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYYALVAMLIAGLIYKYIEYRGA
EKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLV
LVRVDQDQNVVHPQLLSLTSQ
LKAGKGLTIVGSVLEGTFLENHPQAQRAEESIRRLMEAEKVKGFCQVVISSNLRDGVSHL
IQSGGLGGLQHNTVLVGWPRNWRQKEDHQTWRNFIELVRETTAGHLALL
VTKNVSMFPGN
PERFSEGSIDVWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAQMDDNSIQMKKDLTT
FLYHLRITAEVEVVEMHESDISAYTYEKTLVMEQRSQILKQMHLTKNEREREIQSITDES
RGSIRRKNPANTRLRLNVPEETA
GDSEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEG
ETDPEKVHLTWTKDKSVAEKNKGPSPVSSEGIKDFFSMKPEWENLNQSNVRRMHTAVRLN
EVIVKKSRDAKLVLLNMPGPPRNRNGDENYMEFLEVLTEHLDRVMLVRGGGREVITIYS
Sequence length 1139
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  GABAergic synapse   Cation-coupled Chloride cotransporters
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Developmental And Epileptic Encephalopathy Developmental and epileptic encephalopathy, 34 rs1555863593, rs1555868402, rs1555863145, rs1600590580, rs2084489672, rs2084648529, rs2084483775, rs863225304, rs863225305, rs863225306 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Epilepsy epilepsy, idiopathic generalized, susceptibility to, 14, Epilepsy, idiopathic generalized, susceptibility to, 14, epilepsy of infancy with migrating focal seizures N/A N/A GenCC, ClinVar
Malignant migrating partial seizures of infancy malignant migrating partial seizures of infancy N/A N/A GenCC
Microcephaly microcephaly N/A N/A ClinVar
Neuroticism Neuroticism N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 37149819, 39650656
Arthritis Rheumatoid Associate 26350950
Autistic Disorder Associate 40074080
beta Thalassemia Stimulate 18024369
Breast Neoplasms Associate 39370816
Carcinogenesis Stimulate 36645171
Carcinoma Hepatocellular Associate 33399102
Carcinoma Hepatocellular Stimulate 36645171
Cell Transformation Neoplastic Associate 36645171
Colorectal Neoplasms Associate 24699064, 25947013