AMIGO1 (adhesion molecule with Ig like domain 1)

Gene

• Entrez ID: 57463
• Gene name: Adhesion molecule with Ig like domain 1
• Gene symbol: AMIGO1
• Synonyms (NCBI Gene): ALI2, AMIGO, AMIGO-1
• Chromosome: 1
• Chromosome location: 1p13.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT040529	hsa-miR-92b-3p	CLASH	23622248
MIRT779815	hsa-miR-204	CLIP-seq
MIRT779816	hsa-miR-211	CLIP-seq
MIRT779817	hsa-miR-3649	CLIP-seq
MIRT779818	hsa-miR-3938	CLIP-seq
MIRT779819	hsa-miR-4433	CLIP-seq
MIRT779820	hsa-miR-4459	CLIP-seq
MIRT779821	hsa-miR-4755-5p	CLIP-seq
MIRT779822	hsa-miR-4768-3p	CLIP-seq
MIRT779823	hsa-miR-4780	CLIP-seq
MIRT779824	hsa-miR-623	CLIP-seq
MIRT2170928	hsa-miR-4639-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	ISS	12629050
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IEA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	ISS	12629050
GO:0007399	Process	Nervous system development	IEA
GO:0007409	Process	Axonogenesis	IEA
GO:0007413	Process	Axonal fasciculation	IEA
GO:0007413	Process	Axonal fasciculation	ISS	12629050
GO:0007420	Process	Brain development	IBA
GO:0008076	Component	Voltage-gated potassium channel complex	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	ISS
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0015459	Function	Potassium channel regulator activity	IEA
GO:0015459	Function	Potassium channel regulator activity	ISS
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0032809	Component	Neuronal cell body membrane	IEA
GO:0032809	Component	Neuronal cell body membrane	ISS
GO:0042552	Process	Myelination	IEA
GO:0042552	Process	Myelination	ISS	12629050
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0050772	Process	Positive regulation of axonogenesis	IEA
GO:0050772	Process	Positive regulation of axonogenesis	ISS	12629050
GO:0051130	Process	Positive regulation of cellular component organization	IEA
GO:0051962	Process	Positive regulation of nervous system development	IEA
GO:0051965	Process	Positive regulation of synapse assembly	IBA
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0106030	Process	Neuron projection fasciculation	IEA
GO:1901381	Process	Positive regulation of potassium ion transmembrane transport	IEA
GO:1901381	Process	Positive regulation of potassium ion transmembrane transport	ISS
GO:1905232	Process	Cellular response to L-glutamate	IEA
GO:1990030	Component	Pericellular basket	IEA

Other IDs

• MIM: 615689
• HGNC: 20824
• e!Ensembl: ENSG00000181754

Protein

• UniProt ID: Q86WK6
• Protein name: Amphoterin-induced protein 1 (AMIGO-1) (Alivin-2)
• Protein function: Promotes growth and fasciculation of neurites from cultured hippocampal neurons. May be involved in fasciculation as well as myelination of developing neural axons. May have a role in regeneration as well as neural plasticity in the adult nervou
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13855	LRR_8	62 → 122	Leucine rich repeat	Repeat
  PF13855	LRR_8	110 → 170	Leucine rich repeat	Repeat
  PF07679	I-set	272 → 358	Immunoglobulin I-set domain	Domain

• Sequence:

  MHPHRDPRGLWLLLPSLSLLLFEVARAGRAVVSCPAACLCASNILSCSKQQLPNVPHSLP
  SYTALLDLSHNNLSRLRAEWTPTRLTQLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSN
  QLRTLDEFLFSDLQVLEVLLLYNNHIMAVDRCAFDDMAQLQKLYLSQNQISRFPLELVKE
  GAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHNNPLNCDCELYQLFSHWQYRQ
  LSSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKV
  WVTPSNERVLDEVTNGTVSVSKDGSLLFQQVQVEDGGVYTCYAMGETFNETLSVELKVHN
  FTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLS
  TTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPE
  SVSSVFSDTPIVV

• Sequence length: 493