Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	574537
Gene name	UDP glucuronosyltransferase family 2 member A2
Gene symbol	UGT2A2
Synonyms (NCBI Gene)	UDPGT 2A2
Chromosome	4
Chromosome location	4q13.3

Show/Hide all (46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT526567	hsa-miR-548u	PAR-CLIP	22012620
MIRT526566	hsa-miR-7161-5p	PAR-CLIP	22012620
MIRT526565	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT526564	hsa-miR-141-5p	PAR-CLIP	22012620
MIRT526563	hsa-miR-4762-5p	PAR-CLIP	22012620
MIRT526562	hsa-miR-4645-3p	PAR-CLIP	22012620
MIRT526561	hsa-miR-4477a	PAR-CLIP	22012620
MIRT526560	hsa-miR-6509-3p	PAR-CLIP	22012620
MIRT526559	hsa-miR-4436b-5p	PAR-CLIP	22012620
MIRT526567	hsa-miR-548u	PAR-CLIP	22012620
MIRT526566	hsa-miR-7161-5p	PAR-CLIP	22012620
MIRT526565	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT526564	hsa-miR-141-5p	PAR-CLIP	22012620
MIRT526563	hsa-miR-4762-5p	PAR-CLIP	22012620
MIRT526562	hsa-miR-4645-3p	PAR-CLIP	22012620
MIRT526561	hsa-miR-4477a	PAR-CLIP	22012620
MIRT526560	hsa-miR-6509-3p	PAR-CLIP	22012620
MIRT526559	hsa-miR-4436b-5p	PAR-CLIP	22012620
MIRT1473598	hsa-miR-125a-5p	CLIP-seq
MIRT1473599	hsa-miR-125b	CLIP-seq
MIRT1473600	hsa-miR-185	CLIP-seq
MIRT1473601	hsa-miR-214	CLIP-seq
MIRT1473602	hsa-miR-3619-5p	CLIP-seq
MIRT1473603	hsa-miR-410	CLIP-seq
MIRT1473604	hsa-miR-421	CLIP-seq
MIRT1473605	hsa-miR-4270	CLIP-seq
MIRT1473606	hsa-miR-4291	CLIP-seq
MIRT1473607	hsa-miR-4306	CLIP-seq
MIRT1473608	hsa-miR-4319	CLIP-seq
MIRT1473609	hsa-miR-4441	CLIP-seq
MIRT1473610	hsa-miR-4644	CLIP-seq
MIRT1473611	hsa-miR-4732-3p	CLIP-seq
MIRT1473612	hsa-miR-670	CLIP-seq
MIRT1473613	hsa-miR-761	CLIP-seq
MIRT1473614	hsa-miR-922	CLIP-seq
MIRT1473606	hsa-miR-4291	CLIP-seq
MIRT2462858	hsa-miR-3121-3p	CLIP-seq
MIRT2462859	hsa-miR-3123	CLIP-seq
MIRT2462860	hsa-miR-3647-3p	CLIP-seq
MIRT2462861	hsa-miR-3925-5p	CLIP-seq
MIRT2462862	hsa-miR-3927	CLIP-seq
MIRT2462863	hsa-miR-3978	CLIP-seq
MIRT2462864	hsa-miR-4261	CLIP-seq
MIRT2462865	hsa-miR-4282	CLIP-seq
MIRT2462866	hsa-miR-4451	CLIP-seq
MIRT2462867	hsa-miR-539	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	19858781
GO:0008194	Function	UDP-glycosyltransferase activity	IEA
GO:0008206	Process	Bile acid metabolic process	IDA	23756265
GO:0009608	Process	Response to symbiont	IDA	19858781
GO:0015020	Function	Glucuronosyltransferase activity	IBA
GO:0015020	Function	Glucuronosyltransferase activity	IDA	19858781, 23756265
GO:0015020	Function	Glucuronosyltransferase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA

MIM	HGNC	e!Ensembl
619809	28183	ENSG00000271271

P0DTE5

Protein name

UDP-glucuronosyltransferase 2A2 (UDPGT 2A2) (EC 2.4.1.17)

Protein function

UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either th

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Mainly expressed in the nasal mucosa. {ECO:0000269|PubMed:19858781}.

Sequence

MVSIRDFTMPKKFVQMLVFNLTLTEVVLSGNVLIWPTDGSHWLNIKIILEELIQRNHNVT
VLASSATLFINSNPDSPVNFEVIPVSYKKSNIDSLIEHMIMLWIDHRPTPLTIWAFYKEL
GKLLDTFFQINIQLCDGVLKNPKLMARLQKGGFDVLVADPVTICGDLVALKLGIPFMYTL
RFSPASTVERHCGKIPAPVSYVPAALSELTDQMTFGERIKNTISYSLQDYIFQSYWGEWN
SYYSKILGRPTTLCETMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEME
EFIQSSGKNGVVVFSLGSMVKNLTEEKANLIASALAQIPQKVLWRYKGKKPATLGNNTQL
FDWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAV
EVNLNTMTSVDLLSALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGA
KHLRVAAHDLTWFQYHSLDVIGFLLVCVTTAIFLVIQCCLFSCQKFGKIGKKKKRE

Sequence length

536

Interactions

View interactions

	KEGG		Reactome
	Pentose and glucuronate interconversions Ascorbate and aldarate metabolism Steroid hormone biosynthesis Retinol metabolism Porphyrin metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Biosynthesis of cofactors Bile secretion Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation		Glucuronidation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Ovarian Epithelial	Associate	31001917, 31469419	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	35147485	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysgeusia	Associate	35147485	★★★★★ ★☆☆☆☆ Found in Text Mining only
Olfaction Disorders	Associate	35147485	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pain	Associate	29156912	★★★★★ ★☆☆☆☆ Found in Text Mining only

UGT2A2 (UDP glucuronosyltransferase family 2 member A2)