Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5744
Gene name Gene Name - the full gene name approved by the HGNC.
Parathyroid hormone like hormone
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PTHLH
Synonyms (NCBI Gene) Gene synonyms aliases
BDE2, HHM, PLP, PTHR, PTHRP
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p11.22
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs267606985 A>G Pathogenic Missense variant, coding sequence variant
rs267606986 A>G Pathogenic Missense variant, coding sequence variant
rs267606987 T>C Pathogenic Genic downstream transcript variant, stop lost, terminator codon variant
rs267606988 T>A Pathogenic Stop gained, coding sequence variant
rs1555124505 A>G Likely-pathogenic Stop lost, terminator codon variant, splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT035547 hsa-miR-33a-5p Luciferase reporter assay 23453925
MIRT035547 hsa-miR-33a-5p Luciferase reporter assay 23453925
MIRT735610 hsa-miR-370-3p RNA-seq, qRT-PCR 32065449
MIRT1273385 hsa-miR-3942-3p CLIP-seq
MIRT1273386 hsa-miR-4729 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
ETS1 Activation 15072578;8063775
ETS1 Unknown 11590145
NFKB1 Activation 17554373
RELA Activation 17554373
SMAD3 Activation 24330518
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001501 Process Skeletal system development IDA 9008714
GO:0002076 Process Osteoblast development IBA
GO:0005179 Function Hormone activity IBA
GO:0005179 Function Hormone activity IDA 19674967, 35932760
GO:0005179 Function Hormone activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
168470 9607 ENSG00000087494
Protein
UniProt ID P12272
Protein name Parathyroid hormone-related protein (PTH-rP) (PTHrP) (Parathyroid hormone-like protein) (PLP) [Cleaved into: PTHrP[1-36]; PTHrP[38-94]; Osteostatin (PTHrP[107-139])]
Protein function Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport (PubMed:12538599, PubMed:35932760, PubMed:3616618). Acts by binding t
PDB 1BZG , 1M5N , 3FFD , 3H3G , 7UZO , 7UZP , 7VVJ , 8D51 , 8D52 , 8FLR , 8HAF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01279 Parathyroid 34 128 Parathyroid hormone family Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Also expressed in the mammary gland.
Sequence
MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFL
HHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLK
TPGKKKKG
KPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
Sequence length 177
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Hormone signaling
Parathyroid hormone synthesis, secretion and action
  Class B/2 (Secretin family receptors)
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Brachydactyly Brachydactyly type E2 rs267606985, rs267606986, rs267606987, rs267606988 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Attention Deficit Hyperactivity Disorder Attention deficit hyperactivity disorder N/A N/A GWAS
Breast cancer Breast cancer (estrogen-receptor negative), Breast cancer, Breast Cancer in BRCA1 mutation carriers N/A N/A GWAS
Breast Cancer Breast cancer (estrogen-receptor negative, progesterone-receptor negative, and human epidermal growth factor-receptor negative), Postmenopausal breast cancer N/A N/A GWAS
Diabetes Type 2 diabetes, Type 2 diabetes with neurological manifestations (PheCode 250.24) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Achondroplasia Inhibit 12929929
Acro Osteolysis Stimulate 17882547
Acro Osteolysis Associate 26733284, 35908058
Adenocarcinoma Associate 16033073
Allergic Fungal Sinusitis Stimulate 21177983
Arthritis Rheumatoid Stimulate 9525978
Astrocytoma Associate 10942719
Bone Diseases Associate 11369623, 11590145, 11701443, 21085597, 23787729, 26160166, 30689168
Bone Marrow Diseases Associate 26160550
Bone Neoplasms Associate 21625386, 22508574