Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5743
Gene name	Prostaglandin-endoperoxide synthase 2
Gene symbol	PTGS2
Synonyms (NCBI Gene)	COX-2COX2GRIPGHSPGG/HSPGHS-2PHS-2hCox-2
Chromosome	1
Chromosome location	1q31.1
Summary	Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, whi

212

Show/Hide all (212)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004297	hsa-miR-101-3p	qRT-PCRLuciferase reporter assayWestern blot	19133256
MIRT004297	hsa-miR-101-3p	qRT-PCRLuciferase reporter assayWestern blot	19133256
MIRT004659	hsa-miR-26b-5p	Luciferase reporter assayWestern blot	20100477
MIRT004659	hsa-miR-26b-5p	Luciferase reporter assayWestern blot	20100477
MIRT004297	hsa-miR-101-3p	qRT-PCR	20712078
MIRT001603	hsa-let-7b-5p	pSILAC	18668040
MIRT001426	hsa-miR-16-5p	pSILAC	18668040
MIRT006329	hsa-miR-137	Luciferase reporter assayWestern blot	22406049
MIRT006329	hsa-miR-137	Luciferase reporter assayWestern blot	22406049
MIRT006329	hsa-miR-137	Luciferase reporter assayWestern blot	22406049
MIRT006329	hsa-miR-137	Luciferase reporter assayWestern blot	22406049
MIRT006329	hsa-miR-137	Luciferase reporter assayWestern blot	22406049
MIRT006329	hsa-miR-137	Luciferase reporter assayWestern blot	22406049
MIRT006329	hsa-miR-137	Luciferase reporter assayWestern blot	22406049
MIRT006329	hsa-miR-137	Luciferase reporter assayWestern blot	22406049
MIRT006329	hsa-miR-137	Luciferase reporter assayWestern blot	22406049
MIRT006757	hsa-miR-143-3p	Luciferase reporter assay	21790228
MIRT004297	hsa-miR-101-3p	qRT-PCRWestern blot	23013439
MIRT001426	hsa-miR-16-5p	Luciferase reporter assay	23226427
MIRT001426	hsa-miR-16-5p	Luciferase reporter assay	23226427
MIRT017755	hsa-miR-335-5p	Microarray	18185580
MIRT021768	hsa-miR-132-3p	Microarray	17612493
MIRT021956	hsa-miR-128-3p	Microarray	17612493
MIRT022542	hsa-miR-124-3p	Microarray	18668037
MIRT025094	hsa-miR-181a-5p	Microarray	17612493
MIRT004659	hsa-miR-26b-5p	Reporter assay	20100477
MIRT001426	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT001603	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT052956	hsa-miR-199a-3p	Luciferase reporter assayWestern blot	22294637
MIRT052956	hsa-miR-199a-3p	Luciferase reporter assayqRT-PCRWestern blot	22294637
MIRT004659	hsa-miR-26b-5p	Luciferase reporter assayqRT-PCRWestern blot	23374284
MIRT054370	hsa-miR-199a-5p	Luciferase reporter assayWestern blot	24413338
MIRT437360	hsa-miR-589-5p	5RACENext Generation Sequencing (NGS)qRT-PCRWestern blot	23999091
MIRT437360	hsa-miR-589-5p	5RACENext Generation Sequencing (NGS)qRT-PCRWestern blot	23999091
MIRT006757	hsa-miR-143-3p	Luciferase reporter assayqRT-PCRWestern blot	24105952
MIRT437813	hsa-miR-558	Luciferase reporter assay	23611898
MIRT439871	hsa-miR-379-3p	HITS-CLIP	24374217
MIRT439871	hsa-miR-379-3p	HITS-CLIP	24374217
MIRT732182	hsa-miR-26a-5p	Luciferase reporter assayqRT-PCRWestern blot	26959737
MIRT732182	hsa-miR-26a-5p	Luciferase reporter assayqRT-PCRWestern blot	26959737
MIRT732183	hsa-miR-144-3p	Luciferase reporter assayqRT-PCRWestern blot	26959737
MIRT732183	hsa-miR-144-3p	Luciferase reporter assayqRT-PCRWestern blot	26959737
MIRT004297	hsa-miR-101-3p	Luciferase reporter assayqRT-PCRWestern blot	26556718
MIRT004297	hsa-miR-101-3p	Luciferase reporter assayqRT-PCRWestern blot	26556718
MIRT004659	hsa-miR-26b-5p	Luciferase reporter assayWestern blot	27769043
MIRT004297	hsa-miR-101-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	26530100
MIRT004297	hsa-miR-101-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	26530100
MIRT732182	hsa-miR-26a-5p	Luciferase reporter assayqRT-PCRWestern blot	27900011
MIRT052956	hsa-miR-199a-3p	qRT-PCR	33707464
MIRT732182	hsa-miR-26a-5p	Luciferase reporter assayWestern blottingqRT-PCR	35783137
MIRT1273360	hsa-miR-1264	CLIP-seq
MIRT1273361	hsa-miR-1303	CLIP-seq
MIRT1273362	hsa-miR-202	CLIP-seq
MIRT1273363	hsa-miR-412	CLIP-seq
MIRT1273364	hsa-miR-4457	CLIP-seq
MIRT1273365	hsa-miR-4503	CLIP-seq
MIRT1273366	hsa-miR-4659a-3p	CLIP-seq
MIRT1273367	hsa-miR-4659b-3p	CLIP-seq
MIRT1273368	hsa-miR-4678	CLIP-seq
MIRT1273369	hsa-miR-4709-3p	CLIP-seq
MIRT1273370	hsa-miR-4778-3p	CLIP-seq
MIRT1273371	hsa-miR-513b	CLIP-seq
MIRT1273372	hsa-miR-548n	CLIP-seq
MIRT1273373	hsa-miR-548t	CLIP-seq
MIRT1273374	hsa-miR-595	CLIP-seq
MIRT1273375	hsa-miR-659	CLIP-seq
MIRT2080413	hsa-miR-103b	CLIP-seq
MIRT2080414	hsa-miR-1279	CLIP-seq
MIRT2080415	hsa-miR-300	CLIP-seq
MIRT2080416	hsa-miR-3163	CLIP-seq
MIRT2080417	hsa-miR-340	CLIP-seq
MIRT2080418	hsa-miR-381	CLIP-seq
MIRT2080419	hsa-miR-4666-3p	CLIP-seq
MIRT2080420	hsa-miR-4789-5p	CLIP-seq
MIRT2080421	hsa-miR-548p	CLIP-seq
MIRT2306583	hsa-miR-4272	CLIP-seq
MIRT2306584	hsa-miR-4645-3p	CLIP-seq
MIRT2439689	hsa-miR-1915	CLIP-seq
MIRT2439690	hsa-miR-2053	CLIP-seq
MIRT2439691	hsa-miR-214	CLIP-seq
MIRT2439692	hsa-miR-3619-5p	CLIP-seq
MIRT2439693	hsa-miR-4291	CLIP-seq
MIRT2439694	hsa-miR-4726-3p	CLIP-seq
MIRT2439695	hsa-miR-4731-3p	CLIP-seq
MIRT2439696	hsa-miR-4801	CLIP-seq
MIRT2439697	hsa-miR-494	CLIP-seq
MIRT2439698	hsa-miR-543	CLIP-seq
MIRT2439699	hsa-miR-569	CLIP-seq
MIRT2439700	hsa-miR-761	CLIP-seq
MIRT2439701	hsa-miR-922	CLIP-seq
MIRT1273360	hsa-miR-1264	CLIP-seq
MIRT2457410	hsa-miR-219-2-3p	CLIP-seq
MIRT2457411	hsa-miR-2964a-3p	CLIP-seq
MIRT1273363	hsa-miR-412	CLIP-seq
MIRT1273364	hsa-miR-4457	CLIP-seq
MIRT2457412	hsa-miR-4680-3p	CLIP-seq
MIRT2457413	hsa-miR-4724-5p	CLIP-seq
MIRT2457414	hsa-miR-501-3p	CLIP-seq
MIRT2457415	hsa-miR-502-3p	CLIP-seq
MIRT1273371	hsa-miR-513b	CLIP-seq
MIRT1273372	hsa-miR-548n	CLIP-seq
MIRT1273373	hsa-miR-548t	CLIP-seq
MIRT2465931	hsa-miR-4517	CLIP-seq
MIRT1273360	hsa-miR-1264	CLIP-seq
MIRT2604244	hsa-miR-1269	CLIP-seq
MIRT2604245	hsa-miR-1269b	CLIP-seq
MIRT2604246	hsa-miR-1288	CLIP-seq
MIRT2604247	hsa-miR-1323	CLIP-seq
MIRT2604248	hsa-miR-181a	CLIP-seq
MIRT2604249	hsa-miR-181b	CLIP-seq
MIRT2604250	hsa-miR-181c	CLIP-seq
MIRT2604251	hsa-miR-181d	CLIP-seq
MIRT2604252	hsa-miR-183	CLIP-seq
MIRT2604253	hsa-miR-190	CLIP-seq
MIRT2604254	hsa-miR-190b	CLIP-seq
MIRT2439689	hsa-miR-1915	CLIP-seq
MIRT1273362	hsa-miR-202	CLIP-seq
MIRT2604255	hsa-miR-203	CLIP-seq
MIRT2439690	hsa-miR-2053	CLIP-seq
MIRT2439691	hsa-miR-214	CLIP-seq
MIRT2080416	hsa-miR-3163	CLIP-seq
MIRT2604256	hsa-miR-3173-3p	CLIP-seq
MIRT2604257	hsa-miR-3182	CLIP-seq
MIRT2604258	hsa-miR-338-5p	CLIP-seq
MIRT2439692	hsa-miR-3619-5p	CLIP-seq
MIRT2604259	hsa-miR-3646	CLIP-seq
MIRT2604260	hsa-miR-3689a-5p	CLIP-seq
MIRT2604261	hsa-miR-3689b	CLIP-seq
MIRT2604262	hsa-miR-3689e	CLIP-seq
MIRT2604263	hsa-miR-3689f	CLIP-seq
MIRT2604264	hsa-miR-371b-5p	CLIP-seq
MIRT2604265	hsa-miR-3974	CLIP-seq
MIRT1273363	hsa-miR-412	CLIP-seq
MIRT2604266	hsa-miR-4262	CLIP-seq
MIRT2604267	hsa-miR-4265	CLIP-seq
MIRT2306583	hsa-miR-4272	CLIP-seq
MIRT2604268	hsa-miR-4282	CLIP-seq
MIRT2439693	hsa-miR-4291	CLIP-seq
MIRT2604269	hsa-miR-4296	CLIP-seq
MIRT2604270	hsa-miR-4317	CLIP-seq
MIRT2604271	hsa-miR-4322	CLIP-seq
MIRT2604272	hsa-miR-4417	CLIP-seq
MIRT2604273	hsa-miR-4428	CLIP-seq
MIRT1273364	hsa-miR-4457	CLIP-seq
MIRT2604274	hsa-miR-4474-3p	CLIP-seq
MIRT1273365	hsa-miR-4503	CLIP-seq
MIRT2604275	hsa-miR-450b-5p	CLIP-seq
MIRT2604276	hsa-miR-4515	CLIP-seq
MIRT2604277	hsa-miR-4652-3p	CLIP-seq
MIRT1273368	hsa-miR-4678	CLIP-seq
MIRT1273369	hsa-miR-4709-3p	CLIP-seq
MIRT2604278	hsa-miR-4714-3p	CLIP-seq
MIRT2439694	hsa-miR-4726-3p	CLIP-seq
MIRT2439695	hsa-miR-4731-3p	CLIP-seq
MIRT2604279	hsa-miR-4740-5p	CLIP-seq
MIRT2439696	hsa-miR-4801	CLIP-seq
MIRT2604280	hsa-miR-4803	CLIP-seq
MIRT2439697	hsa-miR-494	CLIP-seq
MIRT2604281	hsa-miR-495	CLIP-seq
MIRT2604282	hsa-miR-507	CLIP-seq
MIRT1273371	hsa-miR-513b	CLIP-seq
MIRT2604283	hsa-miR-513c	CLIP-seq
MIRT2604284	hsa-miR-514b-5p	CLIP-seq
MIRT2439698	hsa-miR-543	CLIP-seq
MIRT1273372	hsa-miR-548n	CLIP-seq
MIRT2604285	hsa-miR-548o	CLIP-seq
MIRT1273373	hsa-miR-548t	CLIP-seq
MIRT2604286	hsa-miR-557	CLIP-seq
MIRT2439699	hsa-miR-569	CLIP-seq
MIRT2604287	hsa-miR-577	CLIP-seq
MIRT2604288	hsa-miR-616	CLIP-seq
MIRT2604289	hsa-miR-617	CLIP-seq
MIRT2604290	hsa-miR-622	CLIP-seq
MIRT2604291	hsa-miR-642b	CLIP-seq
MIRT2604292	hsa-miR-656	CLIP-seq
MIRT2439700	hsa-miR-761	CLIP-seq
MIRT2604293	hsa-miR-802	CLIP-seq
MIRT2604294	hsa-miR-889	CLIP-seq
MIRT2439701	hsa-miR-922	CLIP-seq
MIRT1273360	hsa-miR-1264	CLIP-seq
MIRT2439689	hsa-miR-1915	CLIP-seq
MIRT1273362	hsa-miR-202	CLIP-seq
MIRT2604255	hsa-miR-203	CLIP-seq
MIRT2439691	hsa-miR-214	CLIP-seq
MIRT2080416	hsa-miR-3163	CLIP-seq
MIRT2604257	hsa-miR-3182	CLIP-seq
MIRT2439692	hsa-miR-3619-5p	CLIP-seq
MIRT2604259	hsa-miR-3646	CLIP-seq
MIRT1273363	hsa-miR-412	CLIP-seq
MIRT2604268	hsa-miR-4282	CLIP-seq
MIRT2439693	hsa-miR-4291	CLIP-seq
MIRT2604270	hsa-miR-4317	CLIP-seq
MIRT1273364	hsa-miR-4457	CLIP-seq
MIRT1273365	hsa-miR-4503	CLIP-seq
MIRT2604277	hsa-miR-4652-3p	CLIP-seq
MIRT1273368	hsa-miR-4678	CLIP-seq
MIRT1273369	hsa-miR-4709-3p	CLIP-seq
MIRT2439694	hsa-miR-4726-3p	CLIP-seq
MIRT2439695	hsa-miR-4731-3p	CLIP-seq
MIRT2439696	hsa-miR-4801	CLIP-seq
MIRT2604280	hsa-miR-4803	CLIP-seq
MIRT2439697	hsa-miR-494	CLIP-seq
MIRT1273371	hsa-miR-513b	CLIP-seq
MIRT2439698	hsa-miR-543	CLIP-seq
MIRT1273372	hsa-miR-548n	CLIP-seq
MIRT1273373	hsa-miR-548t	CLIP-seq
MIRT2604287	hsa-miR-577	CLIP-seq
MIRT2604288	hsa-miR-616	CLIP-seq
MIRT2604289	hsa-miR-617	CLIP-seq
MIRT2439700	hsa-miR-761	CLIP-seq
MIRT2604293	hsa-miR-802	CLIP-seq
MIRT2439701	hsa-miR-922	CLIP-seq

Show/Hide all (58)

Transcription factor	Regulation	Reference
APC	Repression	10772828;12566320
APC	Unknown	11396184
AR	Repression	18386814
ATF2	Unknown	11278336;12057991
ATF4	Unknown	21244365
CDX1	Activation	21613300
CDX2	Repression	15013430
CEBPB	Activation	16820889;18294142
CEBPB	Repression	18820298
CEBPB	Unknown	10956548;16699180;17556653;7559624
CEBPD	Unknown	7559624
CREB1	Activation	22919060
CREBBP	Unknown	11278336
CTNNB1	Unknown	11396184
DR1	Activation	11840453
EGR1	Repression	15517885
EGR2	Unknown	24007274
ELF3	Unknown	15794755
ENO1	Unknown	19846662
EP300	Activation	12471036
EP300	Unknown	12057991;17237818;17395887
ETV4	Activation	11274170
FOS	Activation	9620167
FOS	Unknown	11278336;12057991;17556653
HDAC1	Activation	17395887
HDAC4	Activation	18820298
HMGA1	Activation	22898640
ING4	Repression	18399550
JUN	Activation	15772294;18294142;9620167
JUN	Unknown	11278336;12057991;16339564;17556653;20237399
JUNB	Activation	9620167
JUND	Activation	9620167
NFIL3	Unknown	1620116
NFKB1	Activation	10827178;12471036;15368354;15387324;15547942;15555528;15997464;16624933;16820889;18057724;18294142;19618291;22001128
NFKB1	Repression	12622742;15517885
NFKB1	Unknown	12067569;12349897;12871860;14988266;15655349;16210649;17556653;17673602;17767925;18973191;19766095;20103608;20669087
NR0B2	Activation	21613300
PGR	Repression	18483177
PPARA	Activation	11412039
PPARG	Activation	11412039
PPARG	Repression	14555539;16506021
PPARG	Unknown	10827178;11278336
RELA	Activation	10827178;12471036;15368354;15387324;15547942;15555528;15997464;16624933;16820889;18057724;18294142;19618291;22001128
RELA	Repression	12622742;15517885
RELA	Unknown	12067569;12349897;12871860;14645117;14988266;15655349;16210649;17556653;17673602;17767925;18973191;19766095;20103608;20669087
SETBP1	Repression	18419541
SP1	Activation	15767339
SP1	Repression	15767339
STAT1	Activation	12586443
STAT1	Unknown	10433370;16685393
STAT2	Activation	12586443
STAT3	Activation	20145033
STAT3	Unknown	21172343
STAT6	Activation	17237818
TCF7L2	Unknown	11396184
TFAP2A	Unknown	16423197
USF1	Repression	18817855
USF2	Unknown	12057991

Show/Hide all (80)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001516	Process	Prostaglandin biosynthetic process	IDA	27642067
GO:0001516	Process	Prostaglandin biosynthetic process	IEA
GO:0001516	Process	Prostaglandin biosynthetic process	ISS
GO:0001516	Process	Prostaglandin biosynthetic process	NAS	20448152
GO:0004601	Function	Peroxidase activity	IEA
GO:0004601	Function	Peroxidase activity	NAS	14511332
GO:0004666	Function	Prostaglandin-endoperoxide synthase activity	IBA
GO:0004666	Function	Prostaglandin-endoperoxide synthase activity	IDA	1380156, 7592599, 7947975, 16373578
GO:0004666	Function	Prostaglandin-endoperoxide synthase activity	IEA
GO:0005515	Function	Protein binding	IPI	24089527, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005637	Component	Nuclear inner membrane	IDA	9545330
GO:0005637	Component	Nuclear inner membrane	IEA
GO:0005640	Component	Nuclear outer membrane	IDA	9545330
GO:0005640	Component	Nuclear outer membrane	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	14511332
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	24089527
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS	24089527
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006693	Process	Prostaglandin metabolic process	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0007566	Process	Embryo implantation	IEA
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008217	Process	Regulation of blood pressure	ISS
GO:0009624	Process	Response to nematode	IEA
GO:0010269	Process	Response to selenium ion	IEA
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	ISS	9630216
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016701	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen	EXP	12391014
GO:0016701	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen	TAS
GO:0016702	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IBA
GO:0019371	Process	Cyclooxygenase pathway	IBA
GO:0019371	Process	Cyclooxygenase pathway	IDA	1380156, 7592599, 7947975
GO:0019371	Process	Cyclooxygenase pathway	IEA
GO:0019371	Process	Cyclooxygenase pathway	IEA
GO:0019372	Process	Lipoxygenase pathway	TAS
GO:0019899	Function	Enzyme binding	IPI	16373578
GO:0020037	Function	Heme binding	IEA
GO:0020037	Function	Heme binding	ISS
GO:0031394	Process	Positive regulation of prostaglandin biosynthetic process	IEA
GO:0031394	Process	Positive regulation of prostaglandin biosynthetic process	NAS	20448152
GO:0031622	Process	Positive regulation of fever generation	IEA
GO:0031622	Process	Positive regulation of fever generation	ISS
GO:0032310	Process	Prostaglandin secretion	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042759	Process	Long-chain fatty acid biosynthetic process	TAS
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043005	Component	Neuron projection	IDA	12355421
GO:0043005	Component	Neuron projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	ISS	9630216
GO:0046697	Process	Decidualization	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050727	Process	Regulation of inflammatory response	NAS	14511332
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:0071456	Process	Cellular response to hypoxia	IEP	21296955
GO:0071471	Process	Cellular response to non-ionic osmotic stress	IEA
GO:0071498	Process	Cellular response to fluid shear stress	IEA
GO:0071636	Process	Positive regulation of transforming growth factor beta production	ISS	9630216
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	ISS	9630216
GO:0090271	Process	Positive regulation of fibroblast growth factor production	ISS	9630216
GO:0090336	Process	Positive regulation of brown fat cell differentiation	IEA
GO:0090336	Process	Positive regulation of brown fat cell differentiation	ISS	20448152
GO:0090362	Process	Positive regulation of platelet-derived growth factor production	ISS
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:0150077	Process	Regulation of neuroinflammatory response	IEA
GO:0150077	Process	Regulation of neuroinflammatory response	ISS
GO:1902219	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress	IEA

MIM	HGNC	e!Ensembl
600262	9605	ENSG00000073756

P35354

Protein name

Prostaglandin G/H synthase 2 (EC 1.14.99.1) (Cyclooxygenase-2) (COX-2) (PHS II) (Prostaglandin H2 synthase 2) (PGH synthase 2) (PGHS-2) (Prostaglandin-endoperoxide synthase 2)

Protein function

Dual cyclooxygenase and peroxidase in the biosynthesis pathway of prostanoids, a class of C20 oxylipins mainly derived from arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate, AA, C20:4(n-6)), with a particular role in the inflammatory response (Pu

PDB

5F19 , 5F1A , 5IKQ , 5IKR , 5IKT , 5IKV , 5KIR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00008	EGF	21 → 53	EGF-like domain	Domain
PF03098	An_peroxidase	201 → 560	Animal haem peroxidase	Domain

Sequence

MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGS
NMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL

Sequence length

604

Interactions

View interactions

	KEGG		Reactome
	Arachidonic acid metabolism Metabolic pathways NF-kappa B signaling pathway Efferocytosis VEGF signaling pathway C-type lectin receptor signaling pathway IL-17 signaling pathway TNF signaling pathway Retrograde endocannabinoid signaling Serotonergic synapse Ovarian steroidogenesis Oxytocin signaling pathway Regulation of lipolysis in adipocytes Alzheimer disease Pathways of neurodegeneration - multiple diseases Leishmaniasis Human cytomegalovirus infection Human papillomavirus infection Kaposi sarcoma-associated herpesvirus infection Pathways in cancer Chemical carcinogenesis - DNA adducts MicroRNAs in cancer Small cell lung cancer		Nicotinamide salvaging Synthesis of 15-eicosatetraenoic acid derivatives Synthesis of Prostaglandins (PG) and Thromboxanes (TX) Interleukin-10 signaling Interleukin-4 and Interleukin-13 signaling Biosynthesis of DHA-derived SPMs Biosynthesis of EPA-derived SPMs Biosynthesis of DPAn-3 SPMs Biosynthesis of electrophilic ω-3 PUFA oxo-derivatives

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cholangiocarcinoma	other	rs5275, rs20417	RCV003312793 RCV003312794

Show/Hide Text Mining Associations (535)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abortion Habitual	Associate	22999790
Achondrogenesis type 2	Associate	31277141
Acidosis	Associate	23613998
Acute Kidney Injury	Associate	34774558
Acute Lung Injury	Associate	36555290
Adenocarcinoma	Associate	11571629, 12468638, 15274307, 15710986, 16327494, 16521222, 16542464, 16681759, 16682957, 16712734, 16733863, 18214062, 19055699, 19630103, 25392182 View all (5 more)
Adenocarcinoma	Stimulate	21969813, 24387269
Adenocarcinoma Follicular	Associate	15913419, 22558476
Adenocarcinoma Follicular	Stimulate	17179688
Adenocarcinoma Mucinous	Associate	31009406
Adenocarcinoma Of Esophagus	Associate	16327494, 16521222
Adenocarcinoma of Lung	Associate	10515422, 11585835, 16542464, 17201164, 17632087, 18453539, 24704993, 25392182, 25465874, 26191267, 26464643, 32556504, 40147173
Adenoma	Associate	10666384, 12767095, 15913419, 16085694, 16158946, 16295777, 17579859, 18167131, 19124115, 19205707, 19755647, 20087348, 20864903, 22460097, 22667343, 29769213 View all (1 more)
Adenoma	Stimulate	17179688, 20427397, 25166592
Adenoma Oxyphilic	Stimulate	17179688
Adenomatous Polyposis Coli	Associate	14726667, 15930344, 18630462, 19124115, 27072264, 27314294
Adenomatous Polyps	Associate	16685273, 34314467
Adenomatous Polyps	Stimulate	18214062
Adenomyosis	Associate	17135033, 20227073, 38239300
AIDS Dementia Complex	Associate	16001969
Allergic Fungal Sinusitis	Associate	22416915, 25573836
Alzheimer Disease	Associate	12050157, 23613363, 24963629, 31861093, 34749366
Alzheimer Disease	Stimulate	22832605
Amyotrophic Lateral Sclerosis	Stimulate	29246232
Amyotrophic lateral sclerosis 1	Stimulate	12437573
Aneurysm	Associate	10388637, 27159620
Aneurysm Ascending Aorta	Associate	35470674
Aneurysm Ruptured	Associate	22588264
Anxiety Disorders	Associate	33849116
Aortic Aneurysm	Associate	10825178, 22588264
Aortic Aneurysm Familial Abdominal 1	Associate	10388637
Arthritis Juvenile	Associate	38001449
Arthritis Psoriatic	Associate	31480263
Arthritis Rheumatoid	Associate	10719816, 12794822, 15077295, 15225373, 16427328, 16508938, 17848581, 26505439, 28708839, 30314410, 33707464, 33977746, 36435778, 36439145, 37667923, 38107658, 9041934 View all (2 more)
Arthritis Rheumatoid	Inhibit	14558087
Arthropathy progressive pseudorheumatoid of childhood	Stimulate	31411323
Ascites	Associate	24187465
Asthma	Associate	18583575, 22416915, 23240010, 23441755, 25721048
Asthma Aspirin Induced	Inhibit	23240010
Asthma Aspirin Induced	Associate	23441755
Astrocytoma	Associate	10501211, 17640750, 35746681
Astrocytoma	Stimulate	21294088
Ataxia Telangiectasia	Stimulate	19584262
Ataxia Telangiectasia	Associate	30085341
Atelosteogenesis type 2	Associate	34425224
Atherosclerosis	Associate	10514410, 10942685, 14752026, 16399867, 16894405, 20332714, 22588264, 28194409, 34427537, 36690661, 40708018
Atherosclerosis	Stimulate	14642682
Atrophy	Stimulate	19522023
Atrophy	Associate	21683347, 32603043
Bacterial Infections	Associate	20717114
Barrett Esophagus	Associate	12121879, 14631367, 14633942, 15231484, 16521222, 16682957, 17403674, 18400718, 21969813, 22667343
Barrett Esophagus	Stimulate	17615180
Bartter Syndrome	Associate	11115075
Bartter syndrome antenatal type 1	Associate	12081585
Beta ketothiolase deficiency	Stimulate	28972958
Bile Duct Neoplasms	Associate	15161010, 24950702, 26423666
Biliary Tract Neoplasms	Associate	19201881
Bipolar Disorder	Associate	22760556
Bisphosphonate Associated Osteonecrosis of the Jaw	Associate	35035862
Blister	Associate	11772972
Bone Marrow Diseases	Associate	18663571
Bowen's Disease	Stimulate	22667343
Brain Neoplasms	Associate	16319525, 16900783
Breast Neoplasms	Associate	10571077, 11901151, 12037025, 12767095, 12784332, 12884024, 15330183, 15753376, 16127422, 16168133, 16421596, 16424122, 16457694, 16497869, 16505480 View all (70 more)
Breast Neoplasms	Inhibit	19244345
Breast Neoplasms	Stimulate	19667157, 23771849
Bronchiolitis Obliterans Syndrome	Associate	21940790
Calcinosis Cutis	Associate	19326179, 35436939, 36757813
Calcinosis Cutis	Stimulate	20046424
Cancer Pain	Stimulate	24443892
Carcinogenesis	Associate	10920275, 11150521, 11733561, 12046075, 12164941, 12480928, 12698187, 12970891, 14675489, 15055524, 15234907, 15285012, 15334675, 15713675, 15816645 View all (63 more)
Carcinogenesis	Stimulate	15753376, 15858127, 19124115, 30580362
Carcinoma	Associate	16080510, 17767717, 20234320, 21412163
Carcinoma Basal Cell	Associate	15610530, 18843292, 24518705, 30845292, 31334675
Carcinoma Basal Cell	Stimulate	22667343
Carcinoma Ductal	Associate	24950714
Carcinoma Ductal	Stimulate	35743985
Carcinoma Ductal Breast	Associate	21153458
Carcinoma Hepatocellular	Associate	11854904, 12046075, 12378621, 15055524, 15298730, 15800977, 16014934, 16094702, 16273635, 16419156, 17451196, 17964630, 18092051, 20652159, 21057160 View all (16 more)
Carcinoma Hepatocellular	Inhibit	15156159
Carcinoma Hepatocellular	Stimulate	23091809
Carcinoma Intraductal Noninfiltrating	Associate	12750248, 16421596, 20427430
Carcinoma Intraductal Noninfiltrating	Stimulate	15753376, 23216814
Carcinoma Lobular	Stimulate	35743985
Carcinoma Non Small Cell Lung	Associate	10515422, 10665651, 11320076, 11882767, 11920472, 12393872, 14971881, 15265936, 16119982, 17697767, 18030354, 18453539, 19031941, 19235531, 20234320 View all (14 more)
Carcinoma Non Small Cell Lung	Stimulate	25137041, 28972958
Carcinoma Ovarian Epithelial	Associate	16681724
Carcinoma Pancreatic Ductal	Associate	16467169, 26675757, 27057636, 31046874, 35184402, 40269781
Carcinoma Pancreatic Ductal	Stimulate	28222855
Carcinoma Papillary	Associate	15475935
Carcinoma Papillary	Stimulate	26498465
Carcinoma Papillary Follicular	Associate	28425432
Carcinoma Renal Cell	Associate	15744816, 16369983, 17284111, 21161467, 25488950, 26925639, 28004769, 29559845, 30580362
Carcinoma Small Cell	Associate	16014119, 30414472
Carcinoma Squamous Cell	Associate	10506169, 11953864, 12209745, 12445196, 12875991, 15173710, 17291249, 19203995, 19596931, 20192574, 21572400, 22038215, 22534023, 25392182, 26960457, 29512696, 34320931 View all (2 more)
Carcinoma Squamous Cell	Stimulate	14976535, 16055866, 22667343
Carcinoma Transitional Cell	Stimulate	11238034
Carcinoma Transitional Cell	Associate	20423998, 21790228, 24083698
Carcinosarcoma	Associate	19900134, 26222488
Cardiomegaly	Associate	17198778
Cardiovascular Diseases	Associate	17495879, 18768181, 19638987, 21114363, 24796340, 36035865
Carotid Stenosis	Associate	26195278, 28704403
Cartilage Diseases	Associate	18205922
Cecal Neoplasms	Associate	20864903
Cell Transformation Neoplastic	Associate	16314473, 23250387, 29215765
Cerebral Infarction	Associate	16529823, 28704403, 31183363, 35856366, 40681605
Cerebrovascular Disorders	Associate	28194409
Cheilitis glandularis	Associate	24387269
Chemical and Drug Induced Liver Injury	Stimulate	22330637
Cholangiocarcinoma	Associate	12800245, 15855163, 16790433, 16966336, 17165088, 19218340, 26125824, 26276523
Cholangiocarcinoma	Stimulate	18507031
Chorioamnionitis	Stimulate	23666959, 25048443
Choroidal Effusions	Associate	33977746
Chronic Disease	Associate	15234907
Chronic Disease	Inhibit	22828789
Chronic Periodontitis	Associate	20042743, 21047437, 22324469
Chronic Urticaria	Associate	38045687
Clear cell metastatic renal cell carcinoma	Associate	28117391
Cleft Palate	Stimulate	28223053
Cognition Disorders	Associate	16001969
Colitis	Associate	22301110, 30227886
Colitis	Stimulate	25071069
Colitis Associated Neoplasms	Associate	35733095
Colitis Collagenous	Stimulate	25071069
Colitis Ulcerative	Associate	10980113, 16273614, 17653443, 30190207, 36272033, 37960728, 39596612
Colonic Diseases	Associate	16085694, 17640979
Colonic Neoplasms	Associate	10930401, 11150521, 11880271, 11986787, 12578839, 15274299, 15632146, 15713675, 18381589, 18587421, 20069397, 21459756, 23580446, 25169526, 8643486
Colonic Neoplasms	Stimulate	7926468
Colonic Polyps	Associate	18214062, 20864903
Colonic Polyps	Inhibit	37756582
Colorectal Neoplasms	Stimulate	10517910, 12598658, 14521608, 15574495, 19016757, 19088039, 19638987, 25169526, 25545478, 25738332, 28402256, 29158365, 30700940
Colorectal Neoplasms	Associate	10917546, 10920275, 10930401, 11733561, 12771929, 12800231, 12970891, 14719508, 15150618, 15156159, 15173859, 15274299, 15285012, 15328521, 15475936 View all (105 more)
Complex Regional Pain Syndromes	Associate	37238642
Congenital disorder of glycosylation type 1A	Associate	34418699
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	16879213
Coronary Artery Disease	Associate	14642682, 24736319, 24796340, 28194409
Coronary Disease	Associate	19046748, 20332714, 28629174, 35866783
Coronary Restenosis	Associate	16399867
Coronavirus Infections	Associate	34281182
COVID 19	Associate	16991002, 33191068, 33751722, 36380355, 37261339
Coxa Magna	Associate	35118903
Crohn Disease	Associate	16273614, 16951496, 19148357, 21124790
Cushing's symphalangism	Stimulate	18190720
Cystic Fibrosis	Associate	15964894, 23090667
Cystitis	Associate	24387269
Cystitis Interstitial	Associate	22738385
Cysts	Associate	31009406
Cytokine Release Syndrome	Stimulate	9138698
Cytomegalovirus Infections	Stimulate	16782382, 37654195
Death	Associate	14508829, 18453539, 22353218, 23221733, 27457107, 32521872, 33623038
Dental Plaque	Associate	28704403, 36690661
Dental Plaque	Stimulate	28704403
Dental Pulp Calcification	Associate	28779848
Depressive Disorder	Associate	23852407
Dermatitis Atopic	Associate	33289509
Desmoid disease hereditary	Associate	24443892
Diabetes Gestational	Stimulate	31061324
Diabetes Mellitus	Stimulate	23360427, 23642086, 28223053, 28985857
Diabetes Mellitus	Associate	24751283, 37033970
Diabetes Mellitus Type 1	Associate	24204704, 25946000
Diabetes Mellitus Type 2	Stimulate	35954211
Diabetes Mellitus Type 2	Associate	39217825
Diabetic Nephropathies	Associate	11499548, 21114363, 33274236, 35932042, 36329882, 36482994, 38013385, 38206700, 39378104
Diabetic Retinopathy	Associate	29626212, 36689408
Diarrhea	Associate	30227886
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	18758643, 24201754
Digestive System Neoplasms	Associate	25339021
Disease	Associate	10993880
Disease Progression	Associate	28583479
Disease Resistance	Associate	15517878
Drug Hypersensitivity	Associate	15997464, 25573836, 30620999
Drug Related Side Effects and Adverse Reactions	Associate	40147173
Duodenitis	Associate	15930344
Dwarfism Pituitary	Inhibit	12767095
Dyslipidemias	Inhibit	26083362
Dyslipidemias	Associate	35227068
Dysmenorrhea	Associate	38239300
Dysplastic Nevus Syndrome	Associate	15858127
Eclampsia	Associate	31378878
Edema	Associate	28779848
Embolic Stroke	Associate	40708018
End Stage Liver Disease	Stimulate	15055524
Endometrial Hyperplasia	Associate	12209724, 17354612, 37603513
Endometrial Neoplasms	Associate	11228540, 12209724, 15016316, 15546508, 15598938, 16884383, 17354612, 17970040, 18204294, 18316157, 19154413, 19407554, 19509570, 19756737, 19891660 View all (7 more)
Endometriosis	Associate	15533352, 18048499, 21601196, 23239446, 23962610, 24133591, 35130311, 39458478
Endometriosis	Stimulate	22608095
Epilepsy	Associate	12470703, 37946105
Epilepsy Partial with Variable Foci	Associate	17135033
Epilepsy Temporal Lobe	Associate	12470703, 37946105
Epstein Barr Virus Infections	Associate	31298328
Erythema Ab Igne	Associate	12081585
Esophageal Neoplasms	Associate	14633942, 15259059, 15685829, 17511025, 19630103, 19633925, 21779349
Esophageal Squamous Cell Carcinoma	Stimulate	12698187, 15259059
Esophageal Squamous Cell Carcinoma	Associate	17220580, 18583546, 18632220, 19463183, 19630103, 21157974, 21468258, 24641411, 25422234, 26323923, 30339710
Esophagitis	Associate	20811626, 26914122
Eye Neoplasms	Associate	19925514
Familial medullary thyroid carcinoma	Associate	16831027
Fatigue	Associate	23852407, 36922030
Fetal Growth Retardation	Stimulate	21832119
Fever	Associate	11032891
Fibrocartilaginous embolism	Associate	34707460
Fibrosis	Associate	18092051, 20652159, 21179273, 22330637, 23091809, 39457089
Fundus Dystrophy Pseudoinflammatory Of Sorsby	Associate	15526363
Gallbladder Diseases	Associate	16733863
Gallbladder Neoplasms	Associate	15968728, 16733863, 17177652, 21283657
Gastritis	Associate	10235197, 34471638
Gastritis Atrophic	Associate	39259113
Gastro enteropancreatic neuroendocrine tumor	Associate	30420588
Gastrointestinal Diseases	Inhibit	12483719
Gastrointestinal Neoplasms	Associate	16712734, 17934641, 18632220, 30339710
Gastrointestinal Neoplasms	Stimulate	29158365
Gastrointestinal Stromal Tumors	Associate	17230613, 21133589, 22654456
Genital Diseases Female	Associate	12209745
Gingivitis	Stimulate	22324469
Glioblastoma	Associate	15816645, 16133570, 25409926, 28333553, 35163465, 35337344, 40312983
Glioma	Associate	19029777, 20406895, 23635401, 25966079, 28333553, 31652556
Glioma	Stimulate	30740906
Gliosarcoma	Inhibit	19900134
Glomerulonephritis IGA	Associate	15882262
Glucosephosphate Dehydrogenase Deficiency	Associate	27097228, 32630408
Gout	Associate	35524416, 36123941
Granuloma Plasma Cell	Stimulate	11238034
Graves Ophthalmopathy	Associate	33488522, 34383782, 9792671
Guillain Barre Syndrome	Associate	22253732, 33751722
Haspeslagh Fryns Muelenaere syndrome	Associate	18579985, 19247455
Head and Neck Neoplasms	Associate	11326316, 24950702
Head and Neck Neoplasms	Stimulate	12698187
Heart Failure	Associate	10825178, 11115075, 17198778, 32105387
Helicobacter Infections	Associate	10980112, 19797925
Helicobacter Infections	Stimulate	12532440, 15929167
Hemangioma Capillary	Associate	25807908
Hematuria	Associate	15882262
Hemorrhage	Associate	22324469
Hepatitis B	Stimulate	21957142
Hepatitis C Chronic	Associate	15479690, 24496160
Hepatitis C Chronic	Stimulate	18092051
Hepatitis Chronic	Associate	21179273, 23091809
Hereditary Breast and Ovarian Cancer Syndrome	Associate	20676755, 24789723
Hereditary leiomyomatosis and renal cell cancer	Associate	20346139
Hippocampal Sclerosis	Stimulate	12470703
Histiocytoma Malignant Fibrous	Associate	17233833
HIV Infections	Associate	27321752
Hodgkin Disease	Associate	20346139
Hyperaldosteronism	Associate	39252231
Hyperglycemia	Stimulate	35607962
Hyperplasia	Stimulate	22588264
Hypersensitivity Immediate	Associate	16965632
Hypertension	Associate	11499548, 29996846
Hypertension Pregnancy Induced	Inhibit	19952427
Hypertrophy	Associate	17198778
Hyperuricemia	Associate	36123941, 39796505
Hypophosphatasia	Associate	16803637
Hypoxia	Stimulate	12050157, 14702352, 15220111, 15334456, 17456758, 17640750, 18936210, 23144021, 24325753, 24471568, 24574272, 29384693, 37540709
Hypoxia	Associate	15550400, 19017360, 20042640, 21533553
Hypoxia Brain	Associate	10825178, 23148666, 24325753
Hypoxia Brain	Stimulate	15220111
Idiopathic Noncirrhotic Portal Hypertension	Associate	18092051
Idiopathic Pulmonary Fibrosis	Inhibit	19487460
Idiopathic Pulmonary Fibrosis	Associate	24652950, 7706493
IgA Vasculitis	Associate	10701683, 9041934
IgA Vasculitis	Inhibit	14558087
Immune System Diseases	Associate	39252231
Immuno hemolytic anemia	Associate	29290789
Infections	Stimulate	16926398, 22568870
Infections	Associate	31664161
Infertility	Associate	24471989
Inflammation	Associate	10235197, 10388637, 11005841, 11171589, 11772972, 12050157, 12115185, 12390516, 12837757, 14526408, 14642682, 15234907, 15731178, 15796182, 15858127 View all (191 more)
Inflammation	Stimulate	10559138, 12871860, 15713675, 15753376, 18225538, 21153458, 25310697, 26423666, 27314294, 28485348, 31316519, 34213019, 34888378
Inflammation	Inhibit	14558087, 18698374, 33998893
Inflammatory Bowel Diseases	Associate	16273614, 17214885, 17640979, 19636412
Inflammatory Breast Neoplasms	Associate	20462604
Insulin Resistance	Associate	33274236
Intermittent Claudication	Associate	19706240
Intervertebral Disc Degeneration	Associate	33764282, 34707460, 37340393, 39528158
Intestinal Diseases	Stimulate	16097073, 19522023
Intestinal Diseases	Associate	23161322
Intestinal Neoplasms	Stimulate	18758643
Intracranial Aneurysm	Associate	22588264
Intracranial Aneurysm	Stimulate	34418699
Intracranial Arteriovenous Malformations	Associate	34185176
Intracranial Embolism	Associate	20192574
Ischemia	Stimulate	29384693
Ischemia	Associate	38049739
Juvenile polyposis syndrome	Stimulate	19124115, 27072264
Keratoacanthoma	Associate	14976535
Keratosis Actinic	Associate	22667343
Kidney Diseases	Associate	21114363
Kidney Neoplasms	Associate	17645803, 38002360
Labor Pain	Associate	20629487, 23666959
Laryngeal Neoplasms	Associate	25736926, 33099940
Leiomyoma	Associate	25001017
Leiomyosarcoma	Associate	21412163
LEOPARD Syndrome	Associate	31112872
Leukemia	Associate	20673699
Leukemia Erythroblastic Acute	Associate	26739353
Leukemia Lymphocytic Chronic B Cell	Stimulate	12358901, 23091809
Leukemia Lymphocytic Chronic B Cell	Associate	16314473
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	37786778
Leukemia Myeloid Acute	Associate	39251712
Leukoplakia	Associate	26960457
Lichen Planus	Stimulate	35074958
Lichen Planus Oral	Associate	35074958
Liposarcoma	Associate	25973067
Liver Cirrhosis	Associate	15055524, 15479690, 21179273, 27982164, 36246566
Liver Diseases	Associate	15479690, 18092051
Liver Failure	Associate	17964630, 26482123
Lung Diseases	Associate	17201164
Lung Injury	Associate	31419078
Lung Neoplasms	Stimulate	11882767, 20606309
Lung Neoplasms	Associate	12686753, 12708493, 15494493, 16034085, 16421596, 16542464, 19755515, 20353998, 21150337, 21572400, 22464751, 22761909, 23943857, 24098479, 24344016 View all (8 more)
Lung Neoplasms	Inhibit	25113252
Lupus Erythematosus Systemic	Associate	36482627, 36871016
Lymphatic Metastasis	Associate	12532441, 15272284, 18319253, 19300368, 20192574, 22371637, 26323923, 26423666, 27057636, 28188432, 28425432, 30106414
Lymphatic Metastasis	Stimulate	18190720, 19509584, 24887090, 26498465, 27457107, 33327467
Lymphoma	Associate	16790692
Lymphoma B Cell	Associate	16790692
Lymphoma B Cell Marginal Zone	Associate	15222024
Lymphoma Follicular	Associate	16790692, 25900875
Lymphoma Large B Cell Diffuse	Associate	16790692
Lymphoma Mantle Cell	Associate	16790692
Lymphoma Non Hodgkin	Associate	12944556
Lymphoma Non Hodgkin	Stimulate	23091809
Macrophage Activation Syndrome	Associate	32988394
Malaria	Associate	31664161
Malaria Cerebral	Inhibit	22730036
Measles	Associate	17538120
Melanoma	Associate	15251468, 15526363, 18537861, 21268068, 21910007, 32388516, 34497154, 36050601
Meningioma	Associate	23250387, 32832554
Menstruation Disturbances	Associate	16603435
Mesothelioma	Associate	15115874, 18831511, 34404424
Mesothelioma Malignant	Associate	20122271, 34404424
Metaplasia	Stimulate	32603043
Microsatellite Instability	Associate	16820091, 26111272
Migraine Disorders	Associate	32997693
Mitochondrial Diseases	Stimulate	18668543
Mixed Tumor Malignant	Associate	26498465
Mouth Diseases	Associate	19197984, 20388794, 22038215, 25579548
Mouth Diseases	Stimulate	19737986
Mouth Neoplasms	Associate	15796182, 19197984, 23250779, 25051199, 27941877
Moyamoya Disease	Associate	10559138
Multiple Myeloma	Associate	15731178, 16247750, 16497971, 16847764, 25070817
Multiple Pulmonary Nodules	Associate	36384712
Muscular Disorders Atrophic	Stimulate	16097073
Myocardial Infarction	Associate	31772617
Myoma	Associate	23690221
Myotonic Dystrophy	Associate	21114363
Nasal Polyps	Associate	16775120, 19251796, 22416915, 23441755
Nasal Polyps	Inhibit	25573836
Nasopharyngeal Carcinoma	Associate	11381123, 15858127, 19591688, 25553117, 26261650, 27765529, 31298328, 31486495, 33277861, 35073820, 36203533, 36555343
Necrosis	Associate	16080510
Neointima	Associate	17515883
Neoplasm Invasiveness	Stimulate	11238034, 12209724, 15800977, 17291249
Neoplasm Invasiveness	Associate	16097070, 20192574, 31009406, 34320931
Neoplasm Invasiveness	Inhibit	19737986
Neoplasm Metastasis	Associate	10917546, 11442675, 12800231, 16097070, 16415009, 16831027, 17659693, 17877615, 18663571, 18758643, 19116446, 19326179, 20046424, 20691996, 21375766 View all (13 more)
Neoplasm Metastasis	Stimulate	15330183, 15754389, 20427430, 27457107
Neoplasm Metastasis	Inhibit	16467169
Neoplasms	Associate	10515422, 10517910, 10917546, 10980113, 11176123, 11381123, 11442675, 11571629, 11728453, 11876163, 11882767, 11891188, 11953864, 12046075, 12393872 View all (253 more)
Neoplasms	Stimulate	12445196, 15753376, 16097073, 16415009, 17291249, 17767717, 17962194, 19633925, 20460721, 21059239, 21375766, 25113252, 25343626, 26257474, 28624843, 28972958, 31046874, 35054980, 8643486 View all (4 more)
Neoplasms	Inhibit	19720908, 26675757, 26917230, 35256587, 36759733
Neoplasms Adipose Tissue	Associate	32655010
Neoplasms Glandular and Epithelial	Associate	17645803
Neoplasms Neuroepithelial	Associate	19661344
Neoplasms Radiation Induced	Associate	30124879
Neoplasms Squamous Cell	Stimulate	12698187
Neoplasms Squamous Cell	Associate	35400214
Nephrosclerosis	Associate	36690661
Nephrotic Syndrome	Associate	34873575
Nerve Degeneration	Associate	12050157, 20180883
Neurilemmoma	Associate	31291992
Neuroblastoma	Associate	11032891, 16001969, 21268077, 22276108
Neurodegenerative Diseases	Associate	31854058
Neuroectodermal Tumors	Associate	34497154
Neurofibromatosis 2	Inhibit	31291992
Neurofibrosarcoma	Associate	24516579
Neuroinflammatory Diseases	Associate	21212632, 22818222
Neuroma Acoustic	Associate	25616959
Neuroschistosomiasis	Associate	18449376
Neurotoxicity Syndromes	Associate	34749366
Nevus Pigmented	Associate	18537861
Non alcoholic Fatty Liver Disease	Associate	34552988, 36380355, 37090698
Obesity	Associate	18350611, 26482123, 28676625, 29132311, 35650335, 35937803, 37252693, 37878496
Obesity	Stimulate	29546532
Obstetric Labor Premature	Stimulate	31411323
Odontogenic Tumors	Associate	24831259, 27279422
Oral Submucous Fibrosis	Associate	23250779
Osteoarthritis	Associate	11840453, 15922185, 16427328, 18547825, 18668543, 22294637, 23611898, 24825461, 26191174, 26505439, 27271770, 27388528, 27515563, 31146598, 33953899, 37548663, 38401067, 9077531 View all (3 more)
Osteoarthritis	Stimulate	15457451, 34547432
Osteoarthritis	Inhibit	21963554
Osteoarthritis Knee	Associate	18471798, 28431586, 39809203
Osteoglophonic dwarfism	Inhibit	38287843
Osteoporosis	Associate	36626454
Osteosarcoma	Associate	19326179, 21375766, 26476537, 31485669
Ovarian Cysts	Associate	18053993
Ovarian Diseases	Associate	18053993, 18367179
Ovarian Diseases	Stimulate	22246450
Ovarian Neoplasms	Associate	11891188, 12181243, 14508829, 15266333, 16328030, 16612714, 17341442, 18306389, 18362203, 19116446, 20559705, 21972293, 22689176, 23962610, 32253841, 39954656 View all (1 more)
Overweight	Stimulate	17767717
Pain	Associate	11032891, 17354612, 19773451, 22294637, 22464751, 23611898, 24443892, 28668088, 28779848, 34707460, 40076829
Pain	Stimulate	22337942
Pancreatic Cyst	Associate	31009406
Pancreatic Intraductal Neoplasms	Associate	11920515
Pancreatic Neoplasms	Associate	15222037, 15476283, 16319525, 16467169, 17201164, 17950526, 18571585, 20397266, 22039326, 24912820, 24950702
Pancreatic Neoplasms	Stimulate	15685834, 26247532
Pancreaticobiliary Maljunction	Associate	12717864, 15161010
Pancreatitis	Associate	23090667
Papilloma	Associate	17592548, 20131316
Papilloma Inverted	Associate	22534023
Parkinson Disease	Associate	26722563, 31823283, 38027039
Peeling Skin Syndrome	Stimulate	25048443
Pelvic Organ Prolapse	Associate	19056808
Periodontal Diseases	Associate	20042743, 22324469, 23095809, 26743292, 39337647
Periodontal Diseases	Stimulate	22828789
Periodontitis	Associate	21047437, 25483140, 26334995, 34958064, 38206700
Periodontitis	Stimulate	26743292, 34213019
Peripheral Arterial Disease	Associate	19706240
Peritonitis	Associate	33655604
Personality Disorders	Associate	19318492
Peutz Jeghers Syndrome	Associate	16775120
Pituitary Neoplasms	Associate	12767095, 22460097
Plaque Atherosclerotic	Associate	29384693
Plasma Cell Granuloma Pulmonary	Associate	31301770
Pneumonia	Associate	20811626
Pneumothorax	Associate	16965632
Polycystic Ovary Syndrome	Associate	28004769
Polyposis Syndrome Hereditary Mixed 1	Associate	15378772
Polyposis Syndrome Hereditary Mixed 1	Stimulate	21133589
Polyps	Associate	15930344, 20864903, 25835114
Post Acute COVID 19 Syndrome	Associate	36890149
Post Acute COVID 19 Syndrome	Inhibit	36922030
Pre Eclampsia	Associate	33336719, 37817070
Precancerous Conditions	Stimulate	19522023, 34888378
Precancerous Conditions	Associate	22929917, 26218314
Premature Birth	Stimulate	23068965
Premature Birth	Associate	27748297
Prolactin Deficiency Isolated	Associate	12767095
Prostatic Hyperplasia	Associate	30348691
Prostatic Neoplasms	Associate	11442675, 14613585, 15550400, 15963122, 16123581, 17609663, 17998819, 18645679, 19127598, 19139136, 19318492, 19720908, 21694441, 21745389, 21786090 View all (10 more)
Prostatic Neoplasms	Stimulate	21430300
Prostatic Neoplasms Castration Resistant	Associate	18645679
Prostatitis	Associate	11571629, 19318492, 21481131, 9099957
Proteinuria	Associate	15882262
Psoriasis	Associate	31480263, 38115636
Pterygium	Associate	17515883, 19247455, 22219642
Pulmonary Disease Chronic Obstructive	Stimulate	19897740
Pulmonary Disease Chronic Obstructive	Associate	20724130, 30034228, 31419078, 35637927
Pulmonary Fibrosis	Associate	26744410
Radiation Pneumonitis	Associate	34964782
Rectal Neoplasms	Stimulate	10517910
Rectal Neoplasms	Associate	16397240, 17504996, 18392637, 24022467, 28485348
Recurrence	Associate	18579985
Renal Insufficiency	Stimulate	12209745
Renal Insufficiency	Associate	33960101
Reperfusion Injury	Associate	37054936, 38213248
Respiratory Tract Diseases	Associate	21391979, 28583479
Retinal Dysplasia	Stimulate	12698187, 25579548, 32603043
Retinal Dysplasia	Associate	16733863, 18225538, 19522023, 20864903, 31009406
Retinoblastoma	Associate	19925514
Ring Chromosome 20 Syndrome	Associate	38213248
Rupture	Stimulate	22337942
Rupture	Associate	22588264
Sarcoidosis	Associate	19042116
Sarcoma	Associate	16080510
Sarcoma Kaposi	Associate	17868457, 20169190, 24244164
Sarcoma Synovial	Associate	16080510
Sarcopenia	Associate	37629065
Schizophrenia	Associate	37903861
Scleroderma Systemic	Associate	21769840, 26744410, 36389675
Sclerosis	Associate	20346139
Sepsis	Associate	23463959
Severe Acute Respiratory Syndrome	Associate	22730036, 31664161
Severe Acute Respiratory Syndrome	Stimulate	37261339
Sick Sinus Syndrome	Associate	18758643
Sinonasal undifferentiated carcinoma	Associate	36946265
Skin Diseases	Associate	22038215
Skin Diseases	Stimulate	22667343
Skin Neoplasms	Associate	12164941, 22667343
Sleep Apnea Obstructive	Associate	18413499, 28676625, 39252231
Sleep Deprivation	Associate	30862036
Small Cell Lung Carcinoma	Associate	27765529
Soft Tissue Injuries	Associate	15479690, 19661295
Spastic paraplegia 11 autosomal recessive	Stimulate	11238034
Spinal Muscular Atrophies of Childhood	Associate	22730036
Spondylitis Ankylosing	Stimulate	38019769
Squamous Cell Carcinoma of Head and Neck	Associate	11953864, 15272284, 15461861, 18225538, 19074839, 19241124, 19300368, 20558731, 20592893, 24887090, 25579548, 25962348, 26218314, 27941877, 30900666, 32338278 View all (1 more)
Squamous Cell Carcinoma of Head and Neck	Stimulate	19737986
Squamous Intraepithelial Lesions	Associate	18802697, 40156395
Status Asthmaticus	Associate	25180620
Stevens Johnson Syndrome	Associate	25876064
Stomach Diseases	Associate	10980112, 31482734, 32603043
Stomach Neoplasms	Associate	11176123, 11310828, 11854904, 12085263, 12324457, 12532440, 12532441, 12674216, 12679908, 12854133, 15754411, 15793875, 15929167, 15929174, 16097070 View all (42 more)
Stomach Neoplasms	Stimulate	34888378
Stomach Ulcer	Associate	10807888, 15246970
Stroke	Associate	17495879, 21236709, 21424029
Sveinsson Chorioretinal Atrophy	Associate	24149137
Synovial Cyst	Associate	8132748
Synovitis	Associate	10559138
Tachycardia Atrioventricular Nodal Reentry	Associate	26925639, 33623038
Tendinopathy	Associate	29385715
Tertiary Lymphoid Structures	Stimulate	12532441
Tertiary Lymphoid Structures	Associate	12800231, 15754389, 22553404
Thrombocythemia Essential	Associate	19887674
Thrombosis	Associate	29384693
Thyroid cancer medullary	Associate	16831027
Thyroid Cancer Papillary	Associate	15475935, 17179688, 24670538, 33327467
Thyroid Cancer Papillary	Stimulate	26511970
Thyroid Diseases	Associate	26498465
Thyroid Neoplasms	Associate	17179688, 22577338, 29306248, 30140269, 31113465
Thyroiditis	Associate	17179688
Triple Negative Breast Neoplasms	Associate	19758440, 25068292, 28054666, 37540709, 40253988
Triple Negative Breast Neoplasms	Stimulate	24965402
Tuberculosis Multidrug Resistant	Associate	22938493
Tuberculosis Multidrug Resistant	Stimulate	25333456
Tuberculosis Pulmonary	Associate	33099324
Turcot syndrome	Inhibit	38378964
Ulcer	Associate	15246970
Ulcer	Stimulate	19309390
Urethral Neoplasms	Associate	16334139, 18751438
Urinary Bladder Neoplasms	Associate	10880372, 11238034, 18449376, 20423998, 21790228, 23126361, 33238953
Uterine Cervical Dysplasia	Associate	17291249, 18559542, 40156395
Uterine Cervical Dysplasia	Stimulate	27292107
Uterine Cervical Neoplasms	Stimulate	11344234, 26257474, 27292107
Uterine Cervical Neoplasms	Associate	17291249, 19596931, 19949677, 20192574, 20686383, 29279587
Uterine Diseases	Associate	16390782
Uterine Diseases	Inhibit	24471989
Uterine Neoplasms	Associate	38239300
Uveal melanoma	Associate	19432844, 20209608
Varicocele	Associate	36372090
Vascular Diseases	Associate	11005841, 14642682, 19706240, 35245485
Vascular Ring	Associate	35712246
Vascular System Injuries	Associate	35607962
Virus Diseases	Associate	18092051
Vitiligo	Associate	21625016, 23555779, 29094684, 33790887
Vulvar Neoplasms	Associate	19509584
Wilms Tumor	Associate	19157443

PTGS2 (prostaglandin-endoperoxide synthase 2)