Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57412
Gene name Gene Name - the full gene name approved by the HGNC.
Arsenite methyltransferase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
AS3MT
Synonyms (NCBI Gene) Gene synonyms aliases
CYT19
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q24.32
Summary Summary of gene provided in NCBI Entrez Gene.
AS3MT catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (AdoMet) to trivalent arsenical and may play a role in arsenic metabolism (Lin et al., 2002 [PubMed 11790780]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT693079 hsa-miR-34b-3p HITS-CLIP 23313552
MIRT693078 hsa-miR-216a-5p HITS-CLIP 23313552
MIRT693077 hsa-miR-216b-5p HITS-CLIP 23313552
MIRT693076 hsa-miR-6808-5p HITS-CLIP 23313552
MIRT693075 hsa-miR-6893-5p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005829 Component Cytosol IBA 21873635
GO:0005829 Component Cytosol ISS
GO:0005829 Component Cytosol TAS
GO:0008168 Function Methyltransferase activity IBA 21873635
GO:0009404 Process Toxin metabolic process IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611806 17452 ENSG00000214435
Protein
UniProt ID Q9HBK9
Protein name Arsenite methyltransferase (EC 2.1.1.137) (Methylarsonite methyltransferase) (S-adenosyl-L-methionine:arsenic(III) methyltransferase)
Protein function Catalyzes the transfer of a methyl group from AdoMet to trivalent arsenicals producing methylated and dimethylated arsenicals (PubMed:16407288, PubMed:25997655). It methylates arsenite to form methylarsonate, Me-AsO(3)H(2), which is reduced by m
PDB 8XT7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13847 Methyltransf_31 68 242 Methyltransferase domain Domain
Sequence
MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYG
CGLVIPEHLENCWILDLGSGSGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEKYLDYHME
KYGFQASNVTFIHGYIEKLGEAGIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGE
LYFSDVYTSLELPEEIRTHKVLWGECLGGALYWKELAVLAQKIGFCPPRLVTANLITIQN
KE
LERVIGDCRFVSATFRLFKHSKTGPTKRCQVIYNGGITGHEKELMFDANFTFKEGEIV
EVDEETAAILKNSRFAQDFLIRPIGEKLPTSGGCSALELKDIITDPFKLAEESDSMKSRC
VPDAAGGCCGTKKSC
Sequence length 375
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Chemical carcinogenesis - reactive oxygen species   Methylation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Attention deficit hyperactivity disorder Attention Deficit Disorder, Attention deficit hyperactivity disorder rs786205019 25461954, 23453885
Neoplasm Neoplasms, Glandular and Epithelial rs137854562, rs137854565, rs137854568, rs137854574, rs121434220, rs121909218, rs121909222, rs587776667, rs606231169, rs587776701, rs121913388, rs137852578, rs137852216, rs121912651, rs28934575
View all (247 more)
21447609
Coronary artery disease Coronary Artery Disease rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537 23202125, 29212778
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
21791550, 27922604, 23453885, 31374203, 31268507
Unknown
Disease term Disease name Evidence References Source
Mental depression Major Depressive Disorder 23453885 ClinVar
Neuroticism Neuroticism GWAS
Anxiety Disorder Anxiety Disorder GWAS
Myocardial Infarction Myocardial Infarction GWAS
Associations from Text Mining
Disease Name Relationship Type References
Arsenic Poisoning Associate 31864032
Carcinoma Basal Cell Associate 25156000
Carcinoma Hepatocellular Associate 16841956
Cardiovascular Diseases Associate 33737636
Diabetes Mellitus Associate 23093101
Inflammation Associate 35719055
Insulin Resistance Associate 35226250
Lung Neoplasms Associate 28640505
Meningomyelocele Associate 26250961
Migraine Disorders Associate 28957430