Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57412
Gene name Gene Name - the full gene name approved by the HGNC.
Arsenite methyltransferase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
AS3MT
Synonyms (NCBI Gene) Gene synonyms aliases
CYT19
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q24.32
Summary Summary of gene provided in NCBI Entrez Gene.
AS3MT catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (AdoMet) to trivalent arsenical and may play a role in arsenic metabolism (Lin et al., 2002 [PubMed 11790780]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT693079 hsa-miR-34b-3p HITS-CLIP 23313552
MIRT693078 hsa-miR-216a-5p HITS-CLIP 23313552
MIRT693077 hsa-miR-216b-5p HITS-CLIP 23313552
MIRT693076 hsa-miR-6808-5p HITS-CLIP 23313552
MIRT693075 hsa-miR-6893-5p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IBA
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol ISS
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611806 17452 ENSG00000214435
Protein
UniProt ID Q9HBK9
Protein name Arsenite methyltransferase (EC 2.1.1.137) (Methylarsonite methyltransferase) (S-adenosyl-L-methionine:arsenic(III) methyltransferase)
Protein function Catalyzes the transfer of a methyl group from AdoMet to trivalent arsenicals producing methylated and dimethylated arsenicals (PubMed:16407288, PubMed:25997655). It methylates arsenite to form methylarsonate, Me-AsO(3)H(2), which is reduced by m
PDB 8XT7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13847 Methyltransf_31 68 242 Methyltransferase domain Domain
Sequence
MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYG
CGLVIPEHLENCWILDLGSGSGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEKYLDYHME
KYGFQASNVTFIHGYIEKLGEAGIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGE
LYFSDVYTSLELPEEIRTHKVLWGECLGGALYWKELAVLAQKIGFCPPRLVTANLITIQN
KE
LERVIGDCRFVSATFRLFKHSKTGPTKRCQVIYNGGITGHEKELMFDANFTFKEGEIV
EVDEETAAILKNSRFAQDFLIRPIGEKLPTSGGCSALELKDIITDPFKLAEESDSMKSRC
VPDAAGGCCGTKKSC
Sequence length 375
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Chemical carcinogenesis - reactive oxygen species   Methylation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Anxiety Disorder Anxiety N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Myocardial Infarction Myocardial infarction N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arsenic Poisoning Associate 31864032
Carcinoma Basal Cell Associate 25156000
Carcinoma Hepatocellular Associate 16841956
Cardiovascular Diseases Associate 33737636
Diabetes Mellitus Associate 23093101
Inflammation Associate 35719055
Insulin Resistance Associate 35226250
Lung Neoplasms Associate 28640505
Meningomyelocele Associate 26250961
Migraine Disorders Associate 28957430