Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57405
Gene name Gene Name - the full gene name approved by the HGNC.
SPC25 component of NDC80 kinetochore complex
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SPC25
Synonyms (NCBI Gene) Gene synonyms aliases
AD024, SPBC25, hSpc25
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that may be involved in kinetochore-microtubule interaction and spindle checkpoint activity. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016558 hsa-miR-193b-3p Microarray 20304954
MIRT030123 hsa-miR-26b-5p Microarray 19088304
MIRT564174 hsa-miR-8084 PAR-CLIP 20371350
MIRT531372 hsa-miR-1255a PAR-CLIP 20371350
MIRT531371 hsa-miR-1255b-5p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000777 Component Condensed chromosome kinetochore IBA 21873635
GO:0000777 Component Condensed chromosome kinetochore IDA 14699129
GO:0005515 Function Protein binding IPI 14699129, 14738735, 15961401, 20360068, 24981860, 25416956, 26496610, 28514442, 32296183
GO:0005634 Component Nucleus IEA
GO:0005829 Component Cytosol IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609395 24031 ENSG00000152253
Protein
UniProt ID Q9HBM1
Protein name Kinetochore protein Spc25 (hSpc25)
Protein function Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity (PubMed:14699129, PubMed:14738735). Required for kinetochore integrity and the organization o
PDB 2VE7 , 3IZ0 , 8PPR , 8Q5H
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08234 Spindle_Spc25 148 219 Chromosome segregation protein Spc25 Family
Sequence
MVEDELALFDKSINEFWNKFKSTDTSCQMAGLRDTYKDSIKAFAEKLSVKLKEEERMVEM
FLEYQNQISRQNKLIQEKKDNLLKLIAEVKGKKQELEVLTANIQDLKEEYSRKKETISTA
NKANAERLKRLQKSADLYKDRLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEAR
DYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFT
ATVYN
Sequence length 224
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
RHO GTPases Activate Formins
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Metabolic syndrome Metabolic Syndrome X rs367643250, rs587777380, rs777736953 22399527
Unknown
Disease term Disease name Evidence References Source
Metabolic Syndrome Metabolic Syndrome GWAS
Hyperglycemia Hyperglycemia GWAS
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35810236, 38217547
Breast Neoplasms Associate 31400751, 36705562, 38420826
Carcinogenesis Associate 36147467
Carcinoma Hepatocellular Associate 33111935, 36147467, 37059592
Carcinoma Renal Cell Associate 26061684
Colorectal Neoplasms Associate 35496037
Dermatitis Contact Associate 33318199
Drug Hypersensitivity Associate 33318199
Endometrial Neoplasms Associate 38420826
Inflammation Inhibit 37872583