Gene Gene information from NCBI Gene database.
Entrez ID 57405
Gene name SPC25 component of NDC80 kinetochore complex
Gene symbol SPC25
Synonyms (NCBI Gene)
AD024SPBC25hSpc25
Chromosome 2
Chromosome location 2q24.3
Summary This gene encodes a protein that may be involved in kinetochore-microtubule interaction and spindle checkpoint activity. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
531
miRTarBase ID miRNA Experiments Reference
MIRT016558 hsa-miR-193b-3p Microarray 20304954
MIRT030123 hsa-miR-26b-5p Microarray 19088304
MIRT564174 hsa-miR-8084 PAR-CLIP 20371350
MIRT531372 hsa-miR-1255a PAR-CLIP 20371350
MIRT531371 hsa-miR-1255b-5p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0000775 Component Chromosome, centromeric region IEA
GO:0000776 Component Kinetochore IDA 14699129, 15961401
GO:0000776 Component Kinetochore IEA
GO:0000776 Component Kinetochore NAS 23418356
GO:0000940 Component Outer kinetochore IDA 24530301
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609395 24031 ENSG00000152253
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9HBM1
Protein name Kinetochore protein Spc25 (hSpc25)
Protein function Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity (PubMed:14699129, PubMed:14738735). Required for kinetochore integrity and the organization o
PDB 2VE7 , 3IZ0 , 8PPR , 8Q5H
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08234 Spindle_Spc25 148 219 Chromosome segregation protein Spc25 Family
Sequence
MVEDELALFDKSINEFWNKFKSTDTSCQMAGLRDTYKDSIKAFAEKLSVKLKEEERMVEM
FLEYQNQISRQNKLIQEKKDNLLKLIAEVKGKKQELEVLTANIQDLKEEYSRKKETISTA
NKANAERLKRLQKSADLYKDRLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEAR
DYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFT
ATVYN
Sequence length 224
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
RHO GTPases Activate Formins
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Ovarian serous cystadenocarcinoma Uncertain significance rs146133605 RCV005939224
Thyroid cancer, nonmedullary, 1 Uncertain significance rs146133605 RCV005939225
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35810236, 38217547
Breast Neoplasms Associate 31400751, 36705562, 38420826
Carcinogenesis Associate 36147467
Carcinoma Hepatocellular Associate 33111935, 36147467, 37059592
Carcinoma Renal Cell Associate 26061684
Colorectal Neoplasms Associate 35496037
Dermatitis Contact Associate 33318199
Drug Hypersensitivity Associate 33318199
Endometrial Neoplasms Associate 38420826
Inflammation Inhibit 37872583