Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	57381
Gene name Gene Name - the full gene name approved by the HGNC.	Ras homolog family member J
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RHOJ
Synonyms (NCBI Gene) Gene synonyms aliases	ARHJ, RASL7B, TC10B, TCL
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q23.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes one of the many small GTP-binding proteins in the Rho family shown to be associated with focal adhesions in endothelial cells (PMID: 21148427, 22103495). The encoded protein is activated by vascular endothelial growth factor and may regu

Show/Hide all(45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT710897	hsa-miR-891b	HITS-CLIP	19536157
MIRT710896	hsa-miR-6847-3p	HITS-CLIP	19536157
MIRT710895	hsa-miR-3653-3p	HITS-CLIP	19536157
MIRT710894	hsa-miR-1178-3p	HITS-CLIP	19536157
MIRT710897	hsa-miR-891b	HITS-CLIP	19536157
MIRT710896	hsa-miR-6847-3p	HITS-CLIP	19536157
MIRT710895	hsa-miR-3653-3p	HITS-CLIP	19536157
MIRT710894	hsa-miR-1178-3p	HITS-CLIP	19536157
MIRT710897	hsa-miR-891b	HITS-CLIP	19536157
MIRT710896	hsa-miR-6847-3p	HITS-CLIP	19536157
MIRT710895	hsa-miR-3653-3p	HITS-CLIP	19536157
MIRT710894	hsa-miR-1178-3p	HITS-CLIP	19536157
MIRT710897	hsa-miR-891b	HITS-CLIP	19536157
MIRT710896	hsa-miR-6847-3p	HITS-CLIP	19536157
MIRT710895	hsa-miR-3653-3p	HITS-CLIP	19536157
MIRT710894	hsa-miR-1178-3p	HITS-CLIP	19536157
MIRT1305982	hsa-miR-1264	CLIP-seq
MIRT1305983	hsa-miR-4292	CLIP-seq
MIRT1305984	hsa-miR-4308	CLIP-seq
MIRT1305985	hsa-miR-4769-3p	CLIP-seq
MIRT1305986	hsa-miR-604	CLIP-seq
MIRT1305987	hsa-miR-647	CLIP-seq
MIRT1305988	hsa-miR-942	CLIP-seq
MIRT2393722	hsa-miR-3135b	CLIP-seq
MIRT2393723	hsa-miR-3187-3p	CLIP-seq
MIRT2393724	hsa-miR-3652	CLIP-seq
MIRT2393725	hsa-miR-4430	CLIP-seq
MIRT2393726	hsa-miR-4435	CLIP-seq
MIRT2393727	hsa-miR-4453	CLIP-seq
MIRT2393728	hsa-miR-4505	CLIP-seq
MIRT2393729	hsa-miR-4538	CLIP-seq
MIRT2393730	hsa-miR-4633-3p	CLIP-seq
MIRT2393731	hsa-miR-4701-5p	CLIP-seq
MIRT2393732	hsa-miR-548s	CLIP-seq
MIRT2393733	hsa-miR-588	CLIP-seq
MIRT1305987	hsa-miR-647	CLIP-seq
MIRT2439901	hsa-miR-1245b-3p	CLIP-seq
MIRT2439902	hsa-miR-3942-3p	CLIP-seq
MIRT2439903	hsa-miR-4275	CLIP-seq
MIRT2458198	hsa-miR-1273f	CLIP-seq
MIRT2458199	hsa-miR-143	CLIP-seq
MIRT2458200	hsa-miR-3662	CLIP-seq
MIRT2458201	hsa-miR-4450	CLIP-seq
MIRT2458202	hsa-miR-4708-5p	CLIP-seq
MIRT2458203	hsa-miR-4770	CLIP-seq

Show/Hide all(31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	27660391
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	NAS	10967094
GO:0005515	Function	Protein binding	IPI	25416956, 30158707, 31515488, 32296183, 32814053, 33961781
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IDA	27660391
GO:0005525	Function	GTP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	27660391, 30158707
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006897	Process	Endocytosis	IBA
GO:0007015	Process	Actin filament organization	IBA
GO:0007165	Process	Signal transduction	IBA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0008360	Process	Regulation of cell shape	IEA
GO:0010594	Process	Regulation of endothelial cell migration	IMP	30158707
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0030010	Process	Establishment of cell polarity	IBA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	IMP	10967094
GO:0061299	Process	Retina vasculature morphogenesis in camera-type eye	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IMP	28727754
GO:1903670	Process	Regulation of sprouting angiogenesis	IMP	21628409, 30158707

MIM	HGNC	e!Ensembl
607653	688	ENSG00000126785

Protein

UniProt ID

Q9H4E5

Protein name

Rho-related GTP-binding protein RhoJ (Ras-like protein family member 7B) (Tc10-like GTP-binding protein)

Protein function

Plasma membrane-associated small GTPase specifically involved in angiogenesis (PubMed:21628409, PubMed:24434213, PubMed:30158707). Required for endothelial cell migration during vascular development via its interaction with GLUL (PubMed:30158707

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	23 → 196	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed in endothelial cells in different tissues, such as brain, heart, lung and liver. {ECO:0000269|PubMed:21628409}.

Sequence

MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAV
TVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK
DCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQ
KGLKAVFDEAILTIFHPKKKKKRCSEGHSCCSII

Sequence length

214

Interactions

View interactions

	KEGG		Reactome
	Salmonella infection		Rho GTPase cycle

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Endometriosis	Endometriosis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	28533502, 33979320
Cardiomyopathy Dilated	Associate	25137373
DNA Virus Infections	Associate	22971344
Glioblastoma	Associate	35173528
Melanoma	Associate	22971344, 27660391, 28753606
Neoplasm Metastasis	Associate	28753606
Neoplasms	Associate	28753606, 35173528, 37762382, 37958718
Nevus	Associate	28753606
Osteoporosis	Associate	29924424
Stomach Neoplasms	Associate	32174791
Urethral Neoplasms	Associate	37762382

RHOJ (ras homolog family member J)