Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	57337
Gene name	SUMO specific peptidase 7
Gene symbol	SENP7
Synonyms (NCBI Gene)	-
Chromosome	3
Chromosome location	3q12.3
Summary	The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for many cellular processes. SUMO-specific proteases, such as SENP7, process SUMO precursors to generate a

Show/Hide all (60)

miRTarBase ID	miRNA	Experiments	Reference
MIRT039376	hsa-miR-421	CLASH	23622248
MIRT039004	hsa-let-7a-3p	CLASH	23622248
MIRT1336032	hsa-miR-3065-3p	CLIP-seq
MIRT1336033	hsa-miR-3130-5p	CLIP-seq
MIRT1336034	hsa-miR-3190	CLIP-seq
MIRT1336035	hsa-miR-365	CLIP-seq
MIRT1336036	hsa-miR-410	CLIP-seq
MIRT1336037	hsa-miR-4482	CLIP-seq
MIRT1336038	hsa-miR-4704-3p	CLIP-seq
MIRT1336039	hsa-miR-4715-3p	CLIP-seq
MIRT1336040	hsa-miR-4764-3p	CLIP-seq
MIRT1336041	hsa-miR-1197	CLIP-seq
MIRT1336042	hsa-miR-1224-5p	CLIP-seq
MIRT1336043	hsa-miR-2053	CLIP-seq
MIRT1336044	hsa-miR-4751	CLIP-seq
MIRT1336045	hsa-miR-561	CLIP-seq
MIRT1336046	hsa-miR-590-3p	CLIP-seq
MIRT2099418	hsa-miR-3657	CLIP-seq
MIRT2099419	hsa-miR-409-3p	CLIP-seq
MIRT2099420	hsa-miR-4669	CLIP-seq
MIRT2099421	hsa-miR-676	CLIP-seq
MIRT2619976	hsa-miR-1185	CLIP-seq
MIRT2619977	hsa-miR-1321	CLIP-seq
MIRT2619978	hsa-miR-203	CLIP-seq
MIRT1336032	hsa-miR-3065-3p	CLIP-seq
MIRT1336033	hsa-miR-3130-5p	CLIP-seq
MIRT2619979	hsa-miR-3140-5p	CLIP-seq
MIRT2619980	hsa-miR-3163	CLIP-seq
MIRT2619981	hsa-miR-3188	CLIP-seq
MIRT1336034	hsa-miR-3190	CLIP-seq
MIRT2619982	hsa-miR-3605-5p	CLIP-seq
MIRT2619983	hsa-miR-3662	CLIP-seq
MIRT2619984	hsa-miR-3679-5p	CLIP-seq
MIRT2619985	hsa-miR-4270	CLIP-seq
MIRT2619986	hsa-miR-4427	CLIP-seq
MIRT2619987	hsa-miR-4441	CLIP-seq
MIRT1336037	hsa-miR-4482	CLIP-seq
MIRT1336038	hsa-miR-4704-3p	CLIP-seq
MIRT2619988	hsa-miR-4733-3p	CLIP-seq
MIRT2619989	hsa-miR-4739	CLIP-seq
MIRT2619990	hsa-miR-4756-5p	CLIP-seq
MIRT1336040	hsa-miR-4764-3p	CLIP-seq
MIRT2619976	hsa-miR-1185	CLIP-seq
MIRT2619977	hsa-miR-1321	CLIP-seq
MIRT1336032	hsa-miR-3065-3p	CLIP-seq
MIRT1336033	hsa-miR-3130-5p	CLIP-seq
MIRT2619979	hsa-miR-3140-5p	CLIP-seq
MIRT2619981	hsa-miR-3188	CLIP-seq
MIRT1336034	hsa-miR-3190	CLIP-seq
MIRT2619982	hsa-miR-3605-5p	CLIP-seq
MIRT2619984	hsa-miR-3679-5p	CLIP-seq
MIRT2619985	hsa-miR-4270	CLIP-seq
MIRT2619986	hsa-miR-4427	CLIP-seq
MIRT2619987	hsa-miR-4441	CLIP-seq
MIRT1336037	hsa-miR-4482	CLIP-seq
MIRT1336038	hsa-miR-4704-3p	CLIP-seq
MIRT2619988	hsa-miR-4733-3p	CLIP-seq
MIRT2619989	hsa-miR-4739	CLIP-seq
MIRT2619990	hsa-miR-4756-5p	CLIP-seq
MIRT1336040	hsa-miR-4764-3p	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	20562864, 24018422, 27705803
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016926	Process	Protein desumoylation	IBA
GO:0016926	Process	Protein desumoylation	IEA
GO:0016926	Process	Protein desumoylation	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0070139	Function	SUMO-specific endopeptidase activity	IBA
GO:0070139	Function	SUMO-specific endopeptidase activity	IEA
GO:0070139	Function	SUMO-specific endopeptidase activity	ISS
GO:0099523	Component	Presynaptic cytosol	IEA
GO:0099524	Component	Postsynaptic cytosol	IEA
GO:0140374	Process	Antiviral innate immune response	IEA
GO:0140374	Process	Antiviral innate immune response	ISS

MIM	HGNC	e!Ensembl
612846	30402	ENSG00000138468

Q9BQF6

Protein name

Sentrin-specific protease 7 (EC 3.4.22.-) (SUMO-1-specific protease 2) (Sentrin/SUMO-specific protease SENP7)

Protein function

Protease that acts as a positive regulator of the cGAS-STING pathway by catalyzing desumoylation of CGAS. Desumoylation of CGAS promotes DNA-binding activity of CGAS, subsequent oligomerization and activation (By similarity). Deconjugates SUMO2

PDB

3EAY , 7R2E

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02902	Peptidase_C48	774 → 1039	Ulp1 protease family, C-terminal catalytic domain	Domain

Sequence

MDKRKLGRRPSSSEIITEGKRKKSSSDLSEIRKMLNAKPEDVHVQSPLSKFRSSERWTLP
LQWERSLRNKVISLDHKNKKHIRGCPVTSKSSPERQLKVMLTNVLWTDLGRKFRKTLPRN
DANLCDANKVQSDSLPSTSVDSLETCQKLEPLRQSLNLSERIPRVILTNVLGTELGRKYI
RTPPVTEGSLSDTDNLQSEQLSSSSDGSLESYQNLNPHKSCYLSERGSQRSKTVDDNSAK
QTAHNKEKRRKDDGISLLISDTQPEDLNSGSRGCDHLEQESRNKDVKYSDSKVELTLISR
KTKRRLRNNLPDSQYCTSLDKSTEQTKKQEDDSTISTEFEKPSENYHQDPKLPEEITTKP
TKSDFTKLSSLNSQELTLSNATKSASAGSTTETVENSNSIDIVGISSLVEKDENELNTIE
KPILRGHNEGNQSLISAEPIVVSSDEEGPVEHKSSEILKLQSKQDRETTNENESTSESAL
LELPLITCESVQMSSELCPYNPVMENISSIMPSNEMDLQLDFIFTSVYIGKIKGASKGCV
TITKKYIKIPFQVSLNEISLLVDTTHLKRFGLWKSKDDNHSKRSHAILFFWVSSDYLQEI
QTQLEHSVLSQQSKSSEFIFLELHNPVSQREELKLKDIMTEISIISGELELSYPLSWVQA
FPLFQNLSSKESSFIHYYCVSTCSFPAGVAVAEEMKLKSVSQPSNTDAAKPTYTFLQKQS
SGCYSLSITSNPDEEWREVRHTGLVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVI
IDFYLKYLILEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPNLSMAQRRHKRVRTWT
RHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDFPQTVSQQSQAQQSQNDNKTID
NDLRTTSTLSLSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQNTVQNLREYLEVE
WEVKLKTHRQFSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNFELPIHLEKW
FPRHVIKTKREDIRELILKLHLQQQKGSSS

Sequence length

1050

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
arthrogryposis multiplex congenita with neutropenia and early respiratory failure	Likely pathogenic	rs777487611	RCV003226605	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHROGRYPOSIS MULTIPLEX CONGENITA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELOPROLIFERATIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	30732133	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cachexia	Associate	36417853	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Stimulate	33951297	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Associate	38201907	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Atrophy	Associate	36417853	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	26527005	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Associate	35022662	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatitis	Associate	26527005	★★★★★ ★☆☆☆☆ Found in Text Mining only

SENP7 (SUMO specific peptidase 7)