CBX8 (chromobox 8)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57332
Gene name Gene Name - the full gene name approved by the HGNC.
Chromobox 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CBX8
Synonyms (NCBI Gene) Gene synonyms aliases
PC3, RC1
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q25.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(91)
miRTarBase ID miRNA Experiments Reference
MIRT669210 hsa-miR-509-3p HITS-CLIP 23824327
MIRT669209 hsa-miR-5189-3p HITS-CLIP 23824327
MIRT669208 hsa-miR-505-5p HITS-CLIP 23824327
MIRT669207 hsa-miR-6827-5p HITS-CLIP 23824327
MIRT669206 hsa-miR-1343-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(25)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 19636380, 21282530
GO:0000785 Component Chromatin IBA
GO:0000785 Component Chromatin IDA 19636380
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
617354 15962 ENSG00000141570
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9HC52
Protein name Chromobox protein homolog 8 (Polycomb 3 homolog) (Pc3) (hPc3) (Rectachrome 1)
Protein function Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remod
PDB 2N4Q , 3I91 , 5EQ0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00385 Chromo 11 → 60 Chromo (CHRromatin Organisation MOdifier) domain Domain
PF17218 CBX7_C 349 → 381 CBX family C-terminal motif Motif
Sequence 
MELSAVGERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEER
EREMELYGPKKRGPKPKTFLLKAQAKAKAKTYEFRSDSARGIRIPYPGRSPQDLASTSRA
REGLRNMGLSPPASSTSTSSTCRAEAPRDRDRDRDRDRERDRERERERERERERERERER
GTSRVDDKPSSPGDSSKKRGPKPRKELPDPSQRPLGEPSAGLGEYLKGRKLDDTPSGAGK
FPAGHSVIQLARRQDSDLVQCGVTSPSSAEATGKLAVDTFPARVIKHRAAFLEAKGQGAL
DPNGTRVRHGSGPPSSGGGLYRDMGAQGGRPSLIARIPVARILGDPEEESWSPSLTNLEK
VVVTDVTSNFLTVTIKESNTDQGFFKEKR
Sequence length 389
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Polycomb repressive complex   Oxidative Stress Induced Senescence
SUMOylation of DNA damage response and repair proteins
SUMOylation of transcription cofactors
SUMOylation of chromatin organization proteins
SUMOylation of RNA binding proteins
RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known
Regulation of PTEN gene transcription
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Pancreatic cancer Pancreatic cancer Genome-wide CRISPR-Cas9 screening identifies that hypoxia-inducible factor-1a-induced CBX8 transcription promotes pancreatic cancer progression via IRS1/AKT axis 34853645 CBGDA
Show/Hide Text Mining Associations (30)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 25163496, 36221371
Breast Neoplasms Associate 33400401
Carcinoma Hepatocellular Associate 31495785, 35813444
Carcinoma Renal Cell Associate 35813444
Colorectal Neoplasms Associate 30383736, 31849331, 35681547
Death Associate 34449496
Death Inhibit 35392614
Dyslipidemias Associate 33632238
Eosinophilia Associate 34580195
Esophageal Neoplasms Associate 36221371