Gene Gene information from NCBI Gene database.
Entrez ID 573
Gene name BAG cochaperone 1
Gene symbol BAG1
Synonyms (NCBI Gene)
BAG-1HAPRAP46
Chromosome 9
Chromosome location 9p13.3
Summary The oncogene BCL2 is a membrane protein that blocks a step in a pathway leading to apoptosis or programmed cell death. The protein encoded by this gene binds to BCL2 and is referred to as BCL2-associated athanogene. It enhances the anti-apoptotic effects
miRNA miRNA information provided by mirtarbase database.
304
miRTarBase ID miRNA Experiments Reference
MIRT047188 hsa-miR-182-5p CLASH 23622248
MIRT053755 hsa-miR-494-3p FlowLuciferase reporter assayMicroarrayqRT-PCRWestern blot 24606447
MIRT054749 hsa-miR-28-5p Luciferase reporter assayQRTPCRWestern blot 24843176
MIRT550024 hsa-miR-888-5p PAR-CLIP 21572407
MIRT550023 hsa-miR-939-3p PAR-CLIP 21572407
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
CTCFL Activation 18413740
DNMT1 Unknown 18413740
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0000774 Function Adenyl-nucleotide exchange factor activity IBA
GO:0000774 Function Adenyl-nucleotide exchange factor activity IDA 24318877
GO:0005515 Function Protein binding IPI 9305631, 19060904, 19800331, 24318877, 25036637, 25416956, 26871637, 31515488, 32296183, 33961781
GO:0005634 Component Nucleus HDA 21630459
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601497 937 ENSG00000107262
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99933
Protein name BAG family molecular chaperone regulator 1 (BAG-1) (Bcl-2-associated athanogene 1)
Protein function Co-chaperone for HSP70 and HSC70 chaperone proteins. Acts as a nucleotide-exchange factor (NEF) promoting the release of ADP from the HSP70 and HSC70 proteins thereby triggering client/substrate protein release. Nucleotide release is mediated vi
PDB 1HX1 , 1WXV , 3FZF , 3FZH , 3FZK , 3FZL , 3FZM , 3LDQ , 3M3Z , 5AQF , 5AQG , 5AQH , 5AQI , 5AQJ , 5AQK , 5AQL , 5AQM , 5AQN , 5AQO , 5AQP , 5AQQ , 5AQR , 5AQS , 5AQT , 5AQU , 5AQV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00240 ubiquitin 144 222 Ubiquitin family Domain
PF02179 BAG 227 325 BAG domain Family
Tissue specificity TISSUE SPECIFICITY: Isoform 4 is the most abundantly expressed isoform. It is ubiquitously expressed throughout most tissues, except the liver, colon, breast and uterine myometrium. Isoform 1 is expressed in the ovary and testis. Isoform 4 is expressed in
Sequence
MAQRGGARRPRGDRERLGSRLRALRPGREPRQSEPPAQRGPPPSGRPPARSTASGHDRPT
RGAAAGARRPRMKKKTRRRSTRSEELTRSEELTLSEEATWSEEATQSEEATQGEEMNRSQ
EVTRDEESTRSEEVTREEMAAAGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEV
IGVPQSFQKLIFKGKSLKEMETPLSALGIQDGCRVMLIGKKN
SPQEEVELKKLKHLEKSV
EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPEN
FKDSRLKRKGLVKKVQAFLAECDTV
EQNICQETERLQSTNFALAE
Sequence length 345
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Protein processing in endoplasmic reticulum   Regulation of HSF1-mediated heat shock response
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
10
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs114225550 RCV005913382
Cervical cancer Benign rs114225550 RCV005913385
Clear cell carcinoma of kidney Benign rs114225550 RCV005913386
Colon adenocarcinoma Benign rs114225550 RCV005913381
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 9497101
Adenocarcinoma of Lung Associate 28961027
Adenoma Associate 23023342
Bipolar Disorder Inhibit 24345775
Breast Neoplasms Associate 10576663, 18430249, 19066611, 19151744, 19800331, 24557447, 31883527, 34428256, 34995286, 9497101
Burkitt Lymphoma Associate 24843176
Carcinogenesis Inhibit 17549665
Carcinogenesis Associate 18704778, 23059827, 23108401
Carcinoma Ductal Breast Associate 19066611
Carcinoma Non Small Cell Lung Stimulate 22179630