Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
573
Gene name Gene Name - the full gene name approved by the HGNC.
BAG cochaperone 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BAG1
Synonyms (NCBI Gene) Gene synonyms aliases
BAG-1, HAP, RAP46
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The oncogene BCL2 is a membrane protein that blocks a step in a pathway leading to apoptosis or programmed cell death. The protein encoded by this gene binds to BCL2 and is referred to as BCL2-associated athanogene. It enhances the anti-apoptotic effects
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT047188 hsa-miR-182-5p CLASH 23622248
MIRT053755 hsa-miR-494-3p Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 24606447
MIRT054749 hsa-miR-28-5p Luciferase reporter assay, QRTPCR, Western blot 24843176
MIRT550024 hsa-miR-888-5p PAR-CLIP 21572407
MIRT550023 hsa-miR-939-3p PAR-CLIP 21572407
Transcription factors
Transcription factor Regulation Reference
CTCFL Activation 18413740
DNMT1 Unknown 18413740
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000774 Function Adenyl-nucleotide exchange factor activity IBA
GO:0000774 Function Adenyl-nucleotide exchange factor activity IDA 24318877
GO:0005515 Function Protein binding IPI 9305631, 19060904, 19800331, 24318877, 25036637, 25416956, 26871637, 31515488, 32296183, 33961781
GO:0005634 Component Nucleus HDA 21630459
GO:0005634 Component Nucleus IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601497 937 ENSG00000107262
Protein
UniProt ID Q99933
Protein name BAG family molecular chaperone regulator 1 (BAG-1) (Bcl-2-associated athanogene 1)
Protein function Co-chaperone for HSP70 and HSC70 chaperone proteins. Acts as a nucleotide-exchange factor (NEF) promoting the release of ADP from the HSP70 and HSC70 proteins thereby triggering client/substrate protein release. Nucleotide release is mediated vi
PDB 1HX1 , 1WXV , 3FZF , 3FZH , 3FZK , 3FZL , 3FZM , 3LDQ , 3M3Z , 5AQF , 5AQG , 5AQH , 5AQI , 5AQJ , 5AQK , 5AQL , 5AQM , 5AQN , 5AQO , 5AQP , 5AQQ , 5AQR , 5AQS , 5AQT , 5AQU , 5AQV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00240 ubiquitin 144 222 Ubiquitin family Domain
PF02179 BAG 227 325 BAG domain Family
Tissue specificity TISSUE SPECIFICITY: Isoform 4 is the most abundantly expressed isoform. It is ubiquitously expressed throughout most tissues, except the liver, colon, breast and uterine myometrium. Isoform 1 is expressed in the ovary and testis. Isoform 4 is expressed in
Sequence
MAQRGGARRPRGDRERLGSRLRALRPGREPRQSEPPAQRGPPPSGRPPARSTASGHDRPT
RGAAAGARRPRMKKKTRRRSTRSEELTRSEELTLSEEATWSEEATQSEEATQGEEMNRSQ
EVTRDEESTRSEEVTREEMAAAGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEV
IGVPQSFQKLIFKGKSLKEMETPLSALGIQDGCRVMLIGKKN
SPQEEVELKKLKHLEKSV
EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPEN
FKDSRLKRKGLVKKVQAFLAECDTV
EQNICQETERLQSTNFALAE
Sequence length 345
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Protein processing in endoplasmic reticulum   Regulation of HSF1-mediated heat shock response
<