ZNF630 (zinc finger protein 630)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 57232
Gene name Zinc finger protein 630
Gene symbol ZNF630
Synonyms (NCBI Gene)
dJ54B20.2
Chromosome X
Chromosome location Xp11.23
Summary This gene encodes a protein containing an N-terminal Kruppel-associated box-containing (KRAB) domain and 13 Kruppel-type C2H2 zinc finger domains. This gene resides on an area of chromosome X that has been implicated in nonsyndromic X-linked cognitive dis
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene Gene ontology Other IDs Protein
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
300819 28855 ENSG00000221994
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q2M218
Protein name Zinc finger protein 630
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 7 → 48 KRAB box Family
PF00096 zf-C2H2 264 → 285 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 291 → 313 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 347 → 369 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 403 → 425 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 431 → 453 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 459 → 481 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 487 → 509 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 515 → 537 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 543 → 565 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 571 → 593 Zinc finger, C2H2 type Domain
Sequence 
MIESQEPVTFEDVAVDFTQEEWQQLNPAQKTLHRDVMLETYNHLVSVGCSGIKPDVIFKL
EHGKDPWIIESELSRWIYPDRVKGLESSQQIISGELLFQREILERAPKDNSLYSVLKIWH
IDNQMDRYQGNQDRVLRQVTVISRETLTDEMGSKYSAFGKMFNRCTDLAPLSQKFHKFDS
CENSLKSNSDLLNYNRSYARKNPTKRFRCGRPPKYNASCSVPEKEGFIHTGMEPYGDSQC
EKVLSHKQAHVQYKKFQAREKPNVCSMCGKAFIKKSQLIIHQRIHTGEKPYVCGDCRKAF
SEKSHLIVHQRIHTGEKPYECTKYGRAFSRKSPFTVHQRVHTGEKPYECFECPKAFSQKS
HLIIHQRVHTREKPFECSECRKAFCEMSHLFIHQITHTGKKPYECTECGKTFPRKTQLII
HQRTHTGEKPYKCGECGKTFCQQSHLIGHQRIHTGEKPYVCTDCGKAFSQKSHLTGHQRL
HTGEKPYMCTECGKSFSQKSPLIIHQRIHTGEKPYQCGECGKTFSQKSLLIIHLRVHTGE
KPYECTECGRAFSLKSHLILHQRGHTGEKPYECSECGKAFCGKSPLIIHQKTHPREKTPE
CAESGMTFFWKSQMITYQRRHTGEKPSRCSDCGKAFCQHVYFTGHQNPYRKDTLYIC
Sequence length 657
Interactions View interactions