Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57217
Gene name Gene Name - the full gene name approved by the HGNC.
Tetratricopeptide repeat domain 7A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TTC7A
Synonyms (NCBI Gene) Gene synonyms aliases
GIDID, MINAT, TTC7
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein containing tetratricopeptide repeats. Mutations in this gene disrupt intestinal development and can cause early onset inflammatory bowel disease and intestinal atresia. Alternative splicing results in multiple transcript varian
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs139010200 A>C,G Pathogenic, conflicting-interpretations-of-pathogenicity Non coding transcript variant, coding sequence variant, intron variant, missense variant
rs149602485 T>A,C Pathogenic, conflicting-interpretations-of-pathogenicity Non coding transcript variant, missense variant, coding sequence variant, genic downstream transcript variant, downstream transcript variant
rs150269540 C>T Pathogenic 5 prime UTR variant, non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs201100272 T>C Conflicting-interpretations-of-pathogenicity Coding sequence variant, non coding transcript variant, intron variant, missense variant
rs202044972 G>A,T Pathogenic Coding sequence variant, genic downstream transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002709 hsa-miR-124-3p Microarray 15685193
MIRT002709 hsa-miR-124-3p Microarray 18668037
MIRT002709 hsa-miR-124-3p Microarray 15685193
MIRT047556 hsa-miR-10a-5p CLASH 23622248
MIRT1461803 hsa-miR-1226 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 24417819, 33122718
GO:0005737 Component Cytoplasm IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0006879 Process Intracellular iron ion homeostasis IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609332 19750 ENSG00000068724
Protein
UniProt ID Q9ULT0
Protein name Tetratricopeptide repeat protein 7A (TPR repeat protein 7A)
Protein function Component of a complex required to localize phosphatidylinositol 4-kinase (PI4K) to the plasma membrane (PubMed:23229899, PubMed:24417819). The complex acts as a regulator of phosphatidylinositol 4-phosphate (PtdIns(4)P) synthesis (Probable). In
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13181 TPR_8 745 777 Tetratricopeptide repeat Repeat
PF13181 TPR_8 813 846 Tetratricopeptide repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in epithelial cells of the intestine, thymus, and pancreas (at protein level). {ECO:0000269|PubMed:25546680}.
Sequence
MAAKGAHGSYLKVESELERCRAEGHWDRMPELVRQLQTLSMPGGGGNRRGSPSAAFTFPD
TDDFGKLLLAEALLEQCLKENHAKIKDSMPLLEKNEPKMSEAKNYLSSILNHGRLSPQYM
CEAMLILGKLHYVEGSYRDAISMYARAGIDDMSMENKPLYQMRLLSEAFVIKGLSLERLP
NSIASRFRLTEREEEVITCFERASWIAQVFLQELEKTTNNSTSRHLKGCHPLDYELTYFL
EAALQSAYVKNLKKGNIVKGMRELREVLRTVETKATQNFKVMAAKHLAGVLLHSLSEECY
WSPLSHPLPEFMGKEESSFATQALRKPHLYEGDNLYCPKDNIEEALLLLLISESMATRDV
VLSRVPEQEEDRTVSLQNAAAIYDLLSITLGRRGQYVMLSECLERAMKFAFGEFHLWYQV
ALSMVACGKSAYAVSLLRECVKLRPSDPTVPLMAAKVCIGSLRWLEEAEHFAMMVISLGE
EAGEFLPKGYLALGLTYSLQATDATLKSKQDELHRKALQTLERAQQLAPSDPQVILYVSL
QLALVRQISSAMEQLQEALKVRKDDAHALHLLALLFSAQKHHQHALDVVNMAITEHPENF
NLMFTKVKLEQVLKGPEEALVTCRQVLRLWQTLYSFSQLGGLEKDGSFGEGLTMKKQSGM
HLTLPDAHDADSGSRRASSIAASRLEEAMSELTMPSSVLKQGPMQLWTTLEQIWLQAAEL
FMEQQHLKEAGFCIQEAAGLFPTSHSVLYMRGRLAEVKGNLEEAKQLYKEALTVNPDGVR
IMHSLGLMLSRLGHKSLAQKVLRDAVERQSTCHEAWQGLGEVLQAQGQNEAAVDCFLTAL
ELEASS
PVLPFSIIPREL
Sequence length 858
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
multiple gastrointestinal atresias Multiple gastrointestinal atresias rs1057516047, rs1558568116, rs766411601, rs1572849873, rs1297794582, rs587776972, rs773754673, rs886037747, rs1684975294, rs777469885, rs1673619175, rs876657392, rs786205698, rs147914967 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Common Variable Immunodeficiency common variable immunodeficiency N/A N/A ClinVar
Immunodeficiency gastrointestinal defects and immunodeficiency syndrome 1 N/A N/A GenCC
Intestinal Atresia multiple intestinal atresia N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Autoimmune enteropathy Associate 34985046
Bone Neoplasms Inhibit 37996444
Cognitive Dysfunction Associate 25546680
Colitis Associate 33122718, 34985046
Diarrhea 5 With Tufting Enteropathy Congenital Associate 32293360
Disease Associate 27302973
Early Onset Glaucoma Associate 24417819
Enterocolitis Associate 24417819, 34985046
Gastritis Atrophic Associate 34985046
Immunologic Deficiency Syndromes Inhibit 33122718