Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5720
Gene name Gene Name - the full gene name approved by the HGNC.	Proteasome activator subunit 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSME1
Synonyms (NCBI Gene) Gene synonyms aliases	HEL-S-129m, IFI5111, PA28A, PA28alpha, REGalpha
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q12
Summary Summary of gene provided in NCBI Entrez Gene.	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

Show/Hide all(32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023950	hsa-miR-1-3p	Proteomics	18668040
MIRT029951	hsa-miR-26b-5p	Microarray	19088304
MIRT045261	hsa-miR-186-5p	CLASH	23622248
MIRT043440	hsa-miR-331-3p	CLASH	23622248
MIRT043135	hsa-miR-324-5p	CLASH	23622248
MIRT039420	hsa-miR-421	CLASH	23622248
MIRT1270744	hsa-miR-185	CLIP-seq
MIRT1270745	hsa-miR-4257	CLIP-seq
MIRT1270746	hsa-miR-4270	CLIP-seq
MIRT1270747	hsa-miR-4306	CLIP-seq
MIRT1270748	hsa-miR-4441	CLIP-seq
MIRT1270749	hsa-miR-4644	CLIP-seq
MIRT1270750	hsa-miR-4704-3p	CLIP-seq
MIRT1270751	hsa-miR-4721	CLIP-seq
MIRT2305941	hsa-miR-1289	CLIP-seq
MIRT1270744	hsa-miR-185	CLIP-seq
MIRT2305942	hsa-miR-2110	CLIP-seq
MIRT2305943	hsa-miR-216a	CLIP-seq
MIRT2305944	hsa-miR-2355-5p	CLIP-seq
MIRT2305945	hsa-miR-3150a-3p	CLIP-seq
MIRT2305946	hsa-miR-3198	CLIP-seq
MIRT2305947	hsa-miR-4260	CLIP-seq
MIRT2305948	hsa-miR-4294	CLIP-seq
MIRT1270747	hsa-miR-4306	CLIP-seq
MIRT2305949	hsa-miR-4309	CLIP-seq
MIRT2305950	hsa-miR-4476	CLIP-seq
MIRT1270749	hsa-miR-4644	CLIP-seq
MIRT2305951	hsa-miR-4709-5p	CLIP-seq
MIRT2305952	hsa-miR-4718	CLIP-seq
MIRT2305953	hsa-miR-493	CLIP-seq
MIRT2305954	hsa-miR-516b	CLIP-seq
MIRT2305955	hsa-miR-593	CLIP-seq

Show/Hide all(37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0005515	Function	Protein binding	IPI	16189514, 32296183, 32814053
GO:0005654	Component	Nucleoplasm	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005829	Component	Cytosol	TAS
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008537	Component	Proteasome activator complex	IEA
GO:0010950	Process	Positive regulation of endopeptidase activity	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016579	Process	Protein deubiquitination	TAS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061133	Function	Endopeptidase activator activity	IBA	21873635
GO:0061136	Process	Regulation of proteasomal protein catabolic process	IBA	21873635
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IBA	21873635

MIM	HGNC	e!Ensembl
600654	9568	ENSG00000092010

Protein

UniProt ID

Q06323

Protein name

Proteasome activator complex subunit 1 (11S regulator complex subunit alpha) (REG-alpha) (Activator of multicatalytic protease subunit 1) (Interferon gamma up-regulated I-5111 protein) (IGUP I-5111) (Proteasome activator 28 subunit alpha) (PA28a) (PA28alp

Protein function

Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.

PDB

1AVO , 7DR6 , 7DRW , 7NAO , 7NAP , 8CXB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02251	PA28_alpha	8 → 68	Proteasome activator pa28 alpha subunit	Family
PF02252	PA28_beta	103 → 247	Proteasome activator pa28 beta subunit	Family

Sequence

MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAP
LDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPE
IKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSE
RGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKP
RGETKGMIY

Sequence length

249

Interactions

View interactions

	KEGG		Reactome
	Proteasome Antigen processing and presentation		Activation of NF-kappaB in B cells Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha Cross-presentation of soluble exogenous antigens (endosomes) Autodegradation of Cdh1 by Cdh1:APC/C SCF-beta-TrCP mediated degradation of Emi1 APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Vpu mediated degradation of CD4 Vif-mediated degradation of APOBEC3G SCF(Skp2)-mediated degradation of p27/p21 Degradation of beta-catenin by the destruction complex Downstream TCR signaling Separation of Sister Chromatids FCERI mediated NF-kB activation Autodegradation of the E3 ubiquitin ligase COP1 Regulation of ornithine decarboxylase (ODC) ABC-family proteins mediated transport AUF1 (hnRNP D0) binds and destabilizes mRNA Asymmetric localization of PCP proteins Degradation of AXIN Degradation of DVL Hedgehog ligand biogenesis Hh mutants that don't undergo autocatalytic processing are degraded by ERAD Dectin-1 mediated noncanonical NF-kB signaling CLEC7A (Dectin-1) signaling Degradation of GLI1 by the proteasome GLI3 is processed to GLI3R by the proteasome Hedgehog 'on' state Regulation of RAS by GAPs TNFR2 non-canonical NF-kB pathway NIK-->noncanonical NF-kB signaling Defective CFTR causes cystic fibrosis MAPK6/MAPK4 signaling UCH proteinases Ub-specific processing proteases CDT1 association with the CDC6:ORC:origin complex Orc1 removal from chromatin CDK-mediated phosphorylation and removal of Cdc6 G2/M Checkpoints Ubiquitin Mediated Degradation of Phosphorylated Cdc25A Ubiquitin-dependent degradation of Cyclin D The role of GTSE1 in G2/M progression after G2 checkpoint FBXL7 down-regulates AURKA during mitotic entry and in early mitosis RUNX1 regulates transcription of genes involved in differentiation of HSCs Regulation of RUNX2 expression and activity Regulation of RUNX3 expression and activity Regulation of PTEN stability and activity Neddylation Interleukin-1 signaling Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Carcinoma	Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	16316942
Esophagus neoplasm	Squamous cell carcinoma of esophagus	rs28934578, rs121918714, rs1567556006, rs1575166666	21517111

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text Mining
AA amyloidosis	Inhibit	14997933
Alzheimer Disease	Associate	39392298
Arthritis Gouty	Associate	39511617
Arthritis Rheumatoid	Stimulate	34812532
Arthritis Rheumatoid	Associate	39342401
Autoimmune Diseases of the Nervous System	Associate	16414974
Diabetes Mellitus Type 2	Associate	39342401
Esophageal Squamous Cell Carcinoma	Associate	21517111
Gastritis Atrophic	Inhibit	22370706
Inflammation	Associate	39511617
Multiple Myeloma	Associate	33318477
Neoplasms	Associate	36700205
Ovarian Neoplasms	Associate	20671603
Squamous Cell Carcinoma of Head and Neck	Stimulate	19691830

PSME1 (proteasome activator subunit 1)