Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	57194
Gene name Gene Name - the full gene name approved by the HGNC.	ATPase phospholipid transporting 10A (putative)
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ATP10A
Synonyms (NCBI Gene) Gene synonyms aliases	ATP10C, ATPVA, ATPVC
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q12
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from on

Show/Hide all(33)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016850	hsa-miR-335-5p	Microarray	18185580
MIRT806251	hsa-miR-1255a	CLIP-seq
MIRT806252	hsa-miR-1255b	CLIP-seq
MIRT806253	hsa-miR-19a	CLIP-seq
MIRT806254	hsa-miR-19b	CLIP-seq
MIRT806255	hsa-miR-205	CLIP-seq
MIRT806256	hsa-miR-3124-3p	CLIP-seq
MIRT806257	hsa-miR-3182	CLIP-seq
MIRT806258	hsa-miR-3616-5p	CLIP-seq
MIRT806259	hsa-miR-3647-5p	CLIP-seq
MIRT806260	hsa-miR-377	CLIP-seq
MIRT806261	hsa-miR-4274	CLIP-seq
MIRT806262	hsa-miR-4468	CLIP-seq
MIRT806263	hsa-miR-4680-5p	CLIP-seq
MIRT806264	hsa-miR-4704-3p	CLIP-seq
MIRT806265	hsa-miR-4782-5p	CLIP-seq
MIRT806266	hsa-miR-4795-5p	CLIP-seq
MIRT806267	hsa-miR-573	CLIP-seq
MIRT1938078	hsa-miR-1914	CLIP-seq
MIRT1938079	hsa-miR-3185	CLIP-seq
MIRT806260	hsa-miR-377	CLIP-seq
MIRT1938080	hsa-miR-4643	CLIP-seq
MIRT1938081	hsa-miR-4709-3p	CLIP-seq
MIRT1938082	hsa-miR-570	CLIP-seq
MIRT1938083	hsa-miR-592	CLIP-seq
MIRT1938084	hsa-miR-597	CLIP-seq
MIRT1938085	hsa-miR-653	CLIP-seq
MIRT1938079	hsa-miR-3185	CLIP-seq
MIRT806260	hsa-miR-377	CLIP-seq
MIRT1938080	hsa-miR-4643	CLIP-seq
MIRT1938081	hsa-miR-4709-3p	CLIP-seq
MIRT1938082	hsa-miR-570	CLIP-seq
MIRT1938085	hsa-miR-653	CLIP-seq

Show/Hide all(33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	21914794, 25947375, 31571211
GO:0005524	Function	ATP binding	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	21914794
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	25947375
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006869	Process	Lipid transport	IEA
GO:0008360	Process	Regulation of cell shape	NAS	11353404
GO:0015914	Process	Phospholipid transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	11353404
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	TAS
GO:0045332	Process	Phospholipid translocation	IBA
GO:0045332	Process	Phospholipid translocation	NAS	21914794
GO:0046872	Function	Metal ion binding	IEA
GO:0090554	Function	Phosphatidylcholine floppase activity	IEA
GO:0140326	Function	ATPase-coupled intramembrane lipid transporter activity	IBA
GO:0140326	Function	ATPase-coupled intramembrane lipid transporter activity	IEA
GO:0140326	Function	ATPase-coupled intramembrane lipid transporter activity	NAS	11353404
GO:0140326	Function	ATPase-coupled intramembrane lipid transporter activity	TAS
GO:0140345	Function	Phosphatidylcholine flippase activity	IDA	25947375, 29599178, 30530492
GO:0140351	Function	Glycosylceramide flippase activity	IDA	30530492
GO:0140351	Function	Glycosylceramide flippase activity	IEA
GO:1903527	Process	Positive regulation of membrane tubulation	IDA	29599178
GO:1990531	Component	Phospholipid-translocating ATPase complex	IDA	25947375
GO:1990531	Component	Phospholipid-translocating ATPase complex	IEA
GO:1990531	Component	Phospholipid-translocating ATPase complex	IPI	25947375

MIM	HGNC	e!Ensembl
605855	13542	ENSG00000206190

Protein

UniProt ID

O60312

Protein name

Phospholipid-transporting ATPase VA (EC 7.6.2.1) (ATPase class V type 10A) (Aminophospholipid translocase VA) (P4-ATPase flippase complex alpha subunit ATP10A)

Protein function

Catalytic component of P4-ATPase flippase complex, which catalyzes the hydrolysis of ATP coupled to the transport of phosphatidylcholine (PC) from the outer to the inner leaflet of the plasma membrane (PubMed:25947375, PubMed:29599178, PubMed:30

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16209	PhoLip_ATPase_N	44 → 112	Phospholipid-translocating ATPase N-terminal	Family
PF13246	Cation_ATPase	665 → 781		Family
PF16212	PhoLip_ATPase_C	1057 → 1302	Phospholipid-translocating P-type ATPase C-terminal	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, with highest levels in kidney, followed by lung, brain, prostate, testis, ovary and small intestine.

Sequence

MEREPAGTEEPGPPGRRRRREGRTRTVRSNLLPPPGAEDPAAGAAKGERRRRRGCAQHLA
DNRLKTTKYTLLSFLPKNLFEQFHRPANVYFVFIALLNFVPAVNAFQPGLALAPVLFILA
ITAFRDLWEDYSRHRSDHKINHLGCLVFSREEKKYVNRFWKEIHVGDFVRLRCNEIFPAD
ILLLSSSDPDGLCHIETANLDGETNLKRRQVVRGFSELVSEFNPLTFTSVIECEKPNNDL
SRFRGCIIHDNGKKAGLYKENLLLRGCTLRNTDAVVGIVIYAGHETKALLNNSGPRYKRS
KLERQMNCDVLWCVLLLVCMSLFSAVGHGLWIWRYQEKKSLFYVPKSDGSSLSPVTAAVY
SFLTMIIVLQVLIPISLYVSIEIVKACQVYFINQDMQLYDEETDSQLQCRALNITEDLGQ
IQYIFSDKTGTLTENKMVFRRCTVSGVEYSHDANAQRLARYQEADSEEEEVVPRGGSVSQ
RGSIGSHQSVRVVHRTQSTKSHRRTGSRAEAKRASMLSKHTAFSSPMEKDITPDPKLLEK
VSECDKSLAVARHQEHLLAHLSPELSDVFDFFIALTICNTVVVTSPDQPRTKVRVRFELK
SPVKTIEDFLRRFTPSCLTSGCSSIGSLAANKSSHKLGSSFPSTPSSDGMLLRLEERLGQ
PTSAIASNGYSSQADNWASELAQEQESERELRYEAESPDEAALVYAARAYNCVLVERLHD
QVSVELPHLGRLTFELLHTLGFDSVRKRMSVVIRHPLTDEINVYTKGADSVVMDLLQPCS
SVDARGRHQKKIRSKTQNYLNVYAAEGLRTLCIAKRVLSKEEYACWLQSHLEAESSLENS
EELLFQSAIRLETNLHLLGATGIEDRLQDGVPETISKLRQAGLQIWVLTGDKQETAVNIA
YACKLLDHDEEVITLNATSQEACAALLDQCLCYVQSRGLQRAPEKTKGKVSMRFSSLCPP
STSTASGRRPSLVIDGRSLAYALEKNLEDKFLFLAKQCRSVLCCRSTPLQKSMVVKLVRS
KLKAMTLAIGDGANDVSMIQVADVGVGISGQEGMQAVMASDFAVPKFRYLERLLILHGHW
CYSRLANMVLYFFYKNTMFVGLLFWFQFFCGFSASTMIDQWYLIFFNLLFSSLPPLVTGV
LDRDVPANVLLTNPQLYKSGQNMEEYRPRTFWFNMADAAFQSLVCFSIPYLAYYDSNVDL
FTWGTPIVTIALLTFLLHLGIETKTWTWLNWITCGFSVLLFFTVALIYNASCATCYPPSN
PYWTMQALLGDPVFYLTCLMTPVAALLPRLFFRSLQGRVFPTQLQLARQLTRKSPRRCSA
PKETFAQGRLPKDSGTEHSSGRTVKTSVPLSQPSWHTQQPVCSLEASGEPSTVDMSMPVR
EHTLLEGLSAPAPMSSAPGEAVLRSPGGCPEESKVRAASTGRVTPLSSLFSLPTFSLLNW
ISSWSLVSRLGSVLQFSRTEQLADGQAGRGLPVQPHSGRSGLQGPDHRLLIGASSRRSQ

Sequence length

1499

Interactions

View interactions

	Reactome
			Ion transport by P-type ATPases

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Psoriasis	Psoriasis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	37264161
Angelman Syndrome	Associate	11353404
Autism Spectrum Disorder	Associate	18726118
Autistic Disorder	Associate	11353404
Chromosome 15 ring	Associate	11353404
Death	Associate	32998551
Diabetes Mellitus Type 2	Associate	21901158, 31869513
Insulin Resistance	Associate	29518789
Leukemia Lymphocytic Chronic B Cell	Associate	27060156
Melanoma	Associate	35181301
Multiple Myeloma	Associate	34852710
Neurologic Manifestations	Associate	32233732
Pigmentation Disorders	Associate	35181301
Prader Willi Syndrome	Associate	12920063, 18726118
Seizures	Associate	32233732
T Lymphocytopenia Idiopathic CD4 Positive	Associate	18726118
Uniparental Disomy	Inhibit	18726118
Weight Loss	Associate	21209057

ATP10A (ATPase phospholipid transporting 10A (putative))