Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57190
Gene name Gene Name - the full gene name approved by the HGNC.
Selenoprotein N
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SELENON
Synonyms (NCBI Gene) Gene synonyms aliases
CFTD, CMYO3, CMYP3, MDRS1, RSMD1, RSS, SELN, SEPN1
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a glycoprotein that is localized in the endoplasmic reticulum. It plays an important role in cell protection against oxidative stress, and in the regulation of redox-related calcium homeostasis. Mutations in this gene are associated with
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs41284305 G>A Conflicting-interpretations-of-pathogenicity Coding sequence variant, synonymous variant
rs121908182 G>A Pathogenic Missense variant, coding sequence variant
rs121908184 A>G Pathogenic Initiator codon variant, missense variant
rs121908185 G>A Pathogenic-likely-pathogenic, pathogenic Missense variant, coding sequence variant
rs121908186 G>C Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT066278 hsa-miR-4293 HITS-CLIP 23824327
MIRT653963 hsa-miR-596 HITS-CLIP 23824327
MIRT653962 hsa-miR-1470 HITS-CLIP 23824327
MIRT653961 hsa-miR-4667-3p HITS-CLIP 23824327
MIRT653960 hsa-miR-136-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002086 Process Diaphragm contraction IEA
GO:0003016 Process Respiratory system process IEA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 17474147, 18713863, 33961781
GO:0005739 Component Mitochondrion IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606210 15999 ENSG00000162430
Protein
UniProt ID Q9NZV5
Protein name Selenoprotein N (SelN)
Protein function [Isoform 2]: Plays an important role in cell protection against oxidative stress and in the regulation of redox-related calcium homeostasis. Regulates the calcium level of the ER by protecting the calcium pump ATP2A2 against the oxidoreductase E
Family and domains
Tissue specificity TISSUE SPECIFICITY: Isoform 1 and isoform 2 are expressed in skeletal muscle, brain, lung and placenta. Isoform 2 is also expressed in heart, diaphragm and stomach. {ECO:0000269|PubMed:11528383, ECO:0000269|PubMed:12700173}.
Sequence
MGRARPGQRGPPSPGPAAQPPAPPRRRARSLALLGALLAAAAAAAVRVCARHAEAQAAAR
QELALKTLGTDGLFLFSSLDTDGDMYISPEEFKPIAEKLTGSCSVTQTGVQWCSHSSLQP
QLPWLNUSSCLSLLRSTPAASCEEEELPPDPSEETLTIEARFQPLLPETMTKSKDGFLGV
SRLALSGLRNWTAAASPSAVFATRHFQPFLPPPGQELGEPWWIIPSELSMFTGYLSNNRF
YPPPPKGKEVIIHRLLSMFHPRPFVKTRFAPQGAVACLTAISDFYYTVMFRIHAEFQLSE
PPDFPFWFSPAQFTGHIILSKDATHVRDFRLFVPNHRSLNVDMEWLYGASESSNMEVDIG
YIPQMELEATGPSVPSVILDEDGSMIDSHLPSGEPLQFVFEEIKWQQELSWEEAARRLEV
AMYPFKKVSYLPFTEAFDRAKAENKLVHSILLWGALDDQSCUGSGRTLRETVLESSPILT
LLNESFISTWSLVKELEELQNNQENSSHQKLAGLHLEKYSFPVEMMICLPNGTVVHHINA
NYFLDITSVKPEEIESNLFSFSSTFEDPSTATYMQFLKEGLRRGLPLLQP
Sequence length 590
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
congenital myopathy with fiber type disproportion Congenital myopathy with fiber type disproportion rs886041686, rs121908188, rs1557813850, rs121908184, rs778603129, rs797045950 N/A
Eichsfeld type congenital muscular dystrophy eichsfeld type congenital muscular dystrophy rs1557814066, rs121908186, rs908682527, rs779162837, rs1269951927, rs368104077, rs886041686, rs1174570887, rs368074297, rs121908187, rs960468382, rs747284477, rs886041619, rs1553198611, rs1572226578
View all (25 more)
N/A
Muscular dystrophy muscular dystrophy rs121908185 N/A
congenital myopathy Congenital myopathy 4A, autosomal dominant rs797045950, rs886041584 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 27307030
Carcinoma Hepatocellular Associate 26199857
Colorectal Neoplasms Associate 35807897
Disease Associate 26789268
Dropped Head Syndrome Associate 28221305
Familial Hypophosphatemic Rickets Associate 26789268
Genetic Diseases Inborn Associate 18025044
Malignant Hyperthermia Associate 35698232
Minicore Myopathy with External Ophthalmoplegia Associate 12192640, 15608948, 19797833, 30932294
Mitochondrial Diseases Associate 25735936