Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5717
Gene name	Proteasome 26S subunit, non-ATPase 11
Gene symbol	PSMD11
Synonyms (NCBI Gene)	Rpn6S9p44.5
Chromosome	17
Chromosome location	17q11.2
Summary	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

273

Show/Hide all (273)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027649	hsa-miR-98-5p	Microarray	19088304
MIRT031677	hsa-miR-16-5p	Proteomics	18668040
MIRT048989	hsa-miR-92a-3p	CLASH	23622248
MIRT048802	hsa-miR-93-5p	CLASH	23622248
MIRT047502	hsa-miR-10b-5p	CLASH	23622248
MIRT044706	hsa-miR-320a	CLASH	23622248
MIRT043061	hsa-miR-324-5p	CLASH	23622248
MIRT037727	hsa-miR-744-5p	CLASH	23622248
MIRT037338	hsa-miR-877-5p	CLASH	23622248
MIRT037010	hsa-miR-877-3p	CLASH	23622248
MIRT036621	hsa-miR-940	CLASH	23622248
MIRT036255	hsa-miR-1236-3p	CLASH	23622248
MIRT616002	hsa-miR-449b-3p	HITS-CLIP	23824327
MIRT616001	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT616000	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT609054	hsa-miR-744-3p	HITS-CLIP	24906430
MIRT470182	hsa-miR-6873-5p	PAR-CLIP	24398324
MIRT470181	hsa-miR-6888-5p	PAR-CLIP	24398324
MIRT470180	hsa-miR-4433b-3p	PAR-CLIP	24398324
MIRT470179	hsa-miR-6760-5p	PAR-CLIP	24398324
MIRT470178	hsa-miR-4419a	PAR-CLIP	24398324
MIRT470177	hsa-miR-4510	PAR-CLIP	24398324
MIRT470176	hsa-miR-6127	PAR-CLIP	24398324
MIRT470175	hsa-miR-6129	PAR-CLIP	24398324
MIRT470174	hsa-miR-6130	PAR-CLIP	24398324
MIRT470173	hsa-miR-6133	PAR-CLIP	24398324
MIRT470172	hsa-miR-4481	PAR-CLIP	24398324
MIRT470171	hsa-miR-4745-5p	PAR-CLIP	24398324
MIRT470170	hsa-miR-765	PAR-CLIP	24398324
MIRT470168	hsa-miR-6878-5p	PAR-CLIP	24398324
MIRT470169	hsa-miR-6731-5p	PAR-CLIP	24398324
MIRT470167	hsa-miR-8085	PAR-CLIP	24398324
MIRT470166	hsa-miR-1233-5p	PAR-CLIP	24398324
MIRT470165	hsa-miR-6778-5p	PAR-CLIP	24398324
MIRT470164	hsa-miR-30c-1-3p	PAR-CLIP	24398324
MIRT470163	hsa-miR-30c-2-3p	PAR-CLIP	24398324
MIRT470162	hsa-miR-6788-5p	PAR-CLIP	24398324
MIRT492540	hsa-miR-4476	PAR-CLIP	23592263
MIRT492539	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT492538	hsa-miR-6801-3p	PAR-CLIP	23592263
MIRT492537	hsa-miR-6810-3p	PAR-CLIP	23592263
MIRT492536	hsa-miR-331-3p	PAR-CLIP	23592263
MIRT492534	hsa-miR-4308	PAR-CLIP	23592263
MIRT492535	hsa-miR-4254	PAR-CLIP	23592263
MIRT492533	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT492532	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT470169	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT470167	hsa-miR-8085	PAR-CLIP	23592263
MIRT492531	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT492530	hsa-miR-6515-5p	PAR-CLIP	23592263
MIRT470196	hsa-miR-141-3p	PAR-CLIP	23592263
MIRT470195	hsa-miR-200a-3p	PAR-CLIP	23592263
MIRT470193	hsa-miR-4688	PAR-CLIP	23592263
MIRT470194	hsa-miR-6743-5p	PAR-CLIP	23592263
MIRT470192	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT470191	hsa-miR-1253	PAR-CLIP	23592263
MIRT470190	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT470189	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT470188	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT470187	hsa-miR-1286	PAR-CLIP	23592263
MIRT470186	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT470185	hsa-miR-4434	PAR-CLIP	23592263
MIRT470184	hsa-miR-4516	PAR-CLIP	23592263
MIRT470183	hsa-miR-5703	PAR-CLIP	23592263
MIRT470182	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT470181	hsa-miR-6888-5p	PAR-CLIP	23592263
MIRT470180	hsa-miR-4433b-3p	PAR-CLIP	23592263
MIRT470179	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT470178	hsa-miR-4419a	PAR-CLIP	23592263
MIRT470177	hsa-miR-4510	PAR-CLIP	23592263
MIRT470176	hsa-miR-6127	PAR-CLIP	23592263
MIRT470175	hsa-miR-6129	PAR-CLIP	23592263
MIRT470174	hsa-miR-6130	PAR-CLIP	23592263
MIRT470173	hsa-miR-6133	PAR-CLIP	23592263
MIRT470172	hsa-miR-4481	PAR-CLIP	23592263
MIRT470171	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT470170	hsa-miR-765	PAR-CLIP	23592263
MIRT470168	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT470169	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT470167	hsa-miR-8085	PAR-CLIP	23592263
MIRT470166	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT470165	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT470164	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT470163	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT470162	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT439883	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT439883	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT616002	hsa-miR-449b-3p	HITS-CLIP	23824327
MIRT616001	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT616000	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT470182	hsa-miR-6873-5p	PAR-CLIP	24398324
MIRT470181	hsa-miR-6888-5p	PAR-CLIP	24398324
MIRT470180	hsa-miR-4433b-3p	PAR-CLIP	24398324
MIRT470179	hsa-miR-6760-5p	PAR-CLIP	24398324
MIRT470178	hsa-miR-4419a	PAR-CLIP	24398324
MIRT470177	hsa-miR-4510	PAR-CLIP	24398324
MIRT470176	hsa-miR-6127	PAR-CLIP	24398324
MIRT470175	hsa-miR-6129	PAR-CLIP	24398324
MIRT470174	hsa-miR-6130	PAR-CLIP	24398324
MIRT470173	hsa-miR-6133	PAR-CLIP	24398324
MIRT470172	hsa-miR-4481	PAR-CLIP	24398324
MIRT470171	hsa-miR-4745-5p	PAR-CLIP	24398324
MIRT470170	hsa-miR-765	PAR-CLIP	24398324
MIRT470168	hsa-miR-6878-5p	PAR-CLIP	24398324
MIRT470169	hsa-miR-6731-5p	PAR-CLIP	24398324
MIRT470167	hsa-miR-8085	PAR-CLIP	24398324
MIRT470166	hsa-miR-1233-5p	PAR-CLIP	24398324
MIRT470165	hsa-miR-6778-5p	PAR-CLIP	24398324
MIRT470164	hsa-miR-30c-1-3p	PAR-CLIP	24398324
MIRT470163	hsa-miR-30c-2-3p	PAR-CLIP	24398324
MIRT470162	hsa-miR-6788-5p	PAR-CLIP	24398324
MIRT492540	hsa-miR-4476	PAR-CLIP	23592263
MIRT492539	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT492538	hsa-miR-6801-3p	PAR-CLIP	23592263
MIRT492537	hsa-miR-6810-3p	PAR-CLIP	23592263
MIRT492536	hsa-miR-331-3p	PAR-CLIP	23592263
MIRT492534	hsa-miR-4308	PAR-CLIP	23592263
MIRT492535	hsa-miR-4254	PAR-CLIP	23592263
MIRT492533	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT492532	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT470169	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT470167	hsa-miR-8085	PAR-CLIP	23592263
MIRT492531	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT492530	hsa-miR-6515-5p	PAR-CLIP	23592263
MIRT470196	hsa-miR-141-3p	PAR-CLIP	23592263
MIRT470195	hsa-miR-200a-3p	PAR-CLIP	23592263
MIRT470193	hsa-miR-4688	PAR-CLIP	23592263
MIRT470194	hsa-miR-6743-5p	PAR-CLIP	23592263
MIRT470192	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT470191	hsa-miR-1253	PAR-CLIP	23592263
MIRT470190	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT470189	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT470188	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT470187	hsa-miR-1286	PAR-CLIP	23592263
MIRT470186	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT470185	hsa-miR-4434	PAR-CLIP	23592263
MIRT470184	hsa-miR-4516	PAR-CLIP	23592263
MIRT470183	hsa-miR-5703	PAR-CLIP	23592263
MIRT470182	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT470181	hsa-miR-6888-5p	PAR-CLIP	23592263
MIRT470180	hsa-miR-4433b-3p	PAR-CLIP	23592263
MIRT470179	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT470178	hsa-miR-4419a	PAR-CLIP	23592263
MIRT470177	hsa-miR-4510	PAR-CLIP	23592263
MIRT470176	hsa-miR-6127	PAR-CLIP	23592263
MIRT470175	hsa-miR-6129	PAR-CLIP	23592263
MIRT470174	hsa-miR-6130	PAR-CLIP	23592263
MIRT470173	hsa-miR-6133	PAR-CLIP	23592263
MIRT470172	hsa-miR-4481	PAR-CLIP	23592263
MIRT470171	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT470170	hsa-miR-765	PAR-CLIP	23592263
MIRT470168	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT470169	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT470167	hsa-miR-8085	PAR-CLIP	23592263
MIRT470166	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT470165	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT470164	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT470163	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT470162	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT1270435	hsa-miR-4639-3p	CLIP-seq
MIRT1270436	hsa-miR-515-5p	CLIP-seq
MIRT1270437	hsa-miR-548v	CLIP-seq
MIRT1270438	hsa-miR-603	CLIP-seq
MIRT2079461	hsa-miR-1185	CLIP-seq
MIRT2079462	hsa-miR-1228	CLIP-seq
MIRT2079463	hsa-miR-150	CLIP-seq
MIRT2079464	hsa-miR-3147	CLIP-seq
MIRT2079465	hsa-miR-3605-5p	CLIP-seq
MIRT2079466	hsa-miR-361-3p	CLIP-seq
MIRT2079467	hsa-miR-3652	CLIP-seq
MIRT2079468	hsa-miR-3679-3p	CLIP-seq
MIRT2079469	hsa-miR-3679-5p	CLIP-seq
MIRT2079470	hsa-miR-4258	CLIP-seq
MIRT2079471	hsa-miR-4259	CLIP-seq
MIRT2079472	hsa-miR-4286	CLIP-seq
MIRT2079473	hsa-miR-4430	CLIP-seq
MIRT2079474	hsa-miR-4446-5p	CLIP-seq
MIRT2079475	hsa-miR-4505	CLIP-seq
MIRT1270435	hsa-miR-4639-3p	CLIP-seq
MIRT2079476	hsa-miR-4640-5p	CLIP-seq
MIRT2079477	hsa-miR-4726-5p	CLIP-seq
MIRT2079478	hsa-miR-501-3p	CLIP-seq
MIRT2079479	hsa-miR-502-3p	CLIP-seq
MIRT1270436	hsa-miR-515-5p	CLIP-seq
MIRT1270437	hsa-miR-548v	CLIP-seq
MIRT1270438	hsa-miR-603	CLIP-seq
MIRT2079480	hsa-miR-647	CLIP-seq
MIRT2079481	hsa-miR-767-5p	CLIP-seq
MIRT2079462	hsa-miR-1228	CLIP-seq
MIRT2079467	hsa-miR-3652	CLIP-seq
MIRT2079470	hsa-miR-4258	CLIP-seq
MIRT2079473	hsa-miR-4430	CLIP-seq
MIRT2079475	hsa-miR-4505	CLIP-seq
MIRT1270435	hsa-miR-4639-3p	CLIP-seq
MIRT2079478	hsa-miR-501-3p	CLIP-seq
MIRT2079479	hsa-miR-502-3p	CLIP-seq
MIRT1270436	hsa-miR-515-5p	CLIP-seq
MIRT1270437	hsa-miR-548v	CLIP-seq
MIRT1270438	hsa-miR-603	CLIP-seq
MIRT2079480	hsa-miR-647	CLIP-seq
MIRT2079481	hsa-miR-767-5p	CLIP-seq
MIRT2079462	hsa-miR-1228	CLIP-seq
MIRT2079467	hsa-miR-3652	CLIP-seq
MIRT2079470	hsa-miR-4258	CLIP-seq
MIRT2079473	hsa-miR-4430	CLIP-seq
MIRT2079475	hsa-miR-4505	CLIP-seq
MIRT1270435	hsa-miR-4639-3p	CLIP-seq
MIRT2079478	hsa-miR-501-3p	CLIP-seq
MIRT2079479	hsa-miR-502-3p	CLIP-seq
MIRT1270436	hsa-miR-515-5p	CLIP-seq
MIRT1270438	hsa-miR-603	CLIP-seq
MIRT2079480	hsa-miR-647	CLIP-seq
MIRT2079481	hsa-miR-767-5p	CLIP-seq
MIRT2603035	hsa-miR-1179	CLIP-seq
MIRT2079461	hsa-miR-1185	CLIP-seq
MIRT2079462	hsa-miR-1228	CLIP-seq
MIRT2603036	hsa-miR-186	CLIP-seq
MIRT2079465	hsa-miR-3605-5p	CLIP-seq
MIRT2079466	hsa-miR-361-3p	CLIP-seq
MIRT2079467	hsa-miR-3652	CLIP-seq
MIRT2079468	hsa-miR-3679-3p	CLIP-seq
MIRT2079469	hsa-miR-3679-5p	CLIP-seq
MIRT2079470	hsa-miR-4258	CLIP-seq
MIRT2079473	hsa-miR-4430	CLIP-seq
MIRT2079474	hsa-miR-4446-5p	CLIP-seq
MIRT2079475	hsa-miR-4505	CLIP-seq
MIRT1270435	hsa-miR-4639-3p	CLIP-seq
MIRT2603037	hsa-miR-4773	CLIP-seq
MIRT2079478	hsa-miR-501-3p	CLIP-seq
MIRT2079479	hsa-miR-502-3p	CLIP-seq
MIRT1270436	hsa-miR-515-5p	CLIP-seq
MIRT2603038	hsa-miR-548ac	CLIP-seq
MIRT2603039	hsa-miR-548ae	CLIP-seq
MIRT2603040	hsa-miR-548aj	CLIP-seq
MIRT2603041	hsa-miR-548am	CLIP-seq
MIRT2603042	hsa-miR-548d-3p	CLIP-seq
MIRT2603043	hsa-miR-548n	CLIP-seq
MIRT2603044	hsa-miR-548x	CLIP-seq
MIRT2603045	hsa-miR-548z	CLIP-seq
MIRT1270438	hsa-miR-603	CLIP-seq
MIRT2603046	hsa-miR-615-3p	CLIP-seq
MIRT2079480	hsa-miR-647	CLIP-seq
MIRT2079481	hsa-miR-767-5p	CLIP-seq
MIRT2603035	hsa-miR-1179	CLIP-seq
MIRT2079461	hsa-miR-1185	CLIP-seq
MIRT2079462	hsa-miR-1228	CLIP-seq
MIRT2603036	hsa-miR-186	CLIP-seq
MIRT2079465	hsa-miR-3605-5p	CLIP-seq
MIRT2079466	hsa-miR-361-3p	CLIP-seq
MIRT2079467	hsa-miR-3652	CLIP-seq
MIRT2079468	hsa-miR-3679-3p	CLIP-seq
MIRT2079469	hsa-miR-3679-5p	CLIP-seq
MIRT2079470	hsa-miR-4258	CLIP-seq
MIRT2079473	hsa-miR-4430	CLIP-seq
MIRT2079474	hsa-miR-4446-5p	CLIP-seq
MIRT2079475	hsa-miR-4505	CLIP-seq
MIRT1270435	hsa-miR-4639-3p	CLIP-seq
MIRT2603037	hsa-miR-4773	CLIP-seq
MIRT2079478	hsa-miR-501-3p	CLIP-seq
MIRT2079479	hsa-miR-502-3p	CLIP-seq
MIRT1270436	hsa-miR-515-5p	CLIP-seq
MIRT2603038	hsa-miR-548ac	CLIP-seq
MIRT2603039	hsa-miR-548ae	CLIP-seq
MIRT2603040	hsa-miR-548aj	CLIP-seq
MIRT2603041	hsa-miR-548am	CLIP-seq
MIRT2603042	hsa-miR-548d-3p	CLIP-seq
MIRT2603043	hsa-miR-548n	CLIP-seq
MIRT2603044	hsa-miR-548x	CLIP-seq
MIRT2603045	hsa-miR-548z	CLIP-seq
MIRT1270438	hsa-miR-603	CLIP-seq
MIRT2603046	hsa-miR-615-3p	CLIP-seq
MIRT2079480	hsa-miR-647	CLIP-seq
MIRT2079481	hsa-miR-767-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
FOXO4	Unknown	22972301

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000502	Component	Proteasome complex	TAS	9119060
GO:0005198	Function	Structural molecule activity	IBA
GO:0005515	Function	Protein binding	IPI	16990800, 23455924, 27342858, 32296183, 33961781, 35271311
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005838	Component	Proteasome regulatory particle	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IMP	22972301
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0022624	Component	Proteasome accessory complex	IDA	22972301
GO:0022624	Component	Proteasome accessory complex	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0043248	Process	Proteasome assembly	IMP	22972301
GO:0048863	Process	Stem cell differentiation	IMP	22972301
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
604449	9556	ENSG00000108671

O00231

Protein name

26S proteasome non-ATPase regulatory subunit 11 (26S proteasome regulatory subunit RPN6) (26S proteasome regulatory subunit S9) (26S proteasome regulatory subunit p44.5)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4K , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C , 7W3F , 7W3G , 7W3H , 7W3I , 7W3J , 7W3K , 7W3M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18055	RPN6_N	12 → 129	26S proteasome regulatory subunit RPN6 N-terminal domain	Domain
PF01399	PCI	285 → 389	PCI domain	Domain
PF18503	RPN6_C_helix	393 → 419	26S proteasome subunit RPN6 C-terminal helix domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in embryonic stem cells (ESCs). Expression decreases as ESCs differentiate. {ECO:0000269|PubMed:22972301}.

Sequence

MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKT
GQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSE
KRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHAL
SNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYD
SIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLA
DFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKAD
VERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKK
LT

Sequence length

422

Interactions

View interactions

	KEGG		Reactome
	Proteasome Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Spinocerebellar ataxia Prion disease Pathways of neurodegeneration - multiple diseases Epstein-Barr virus infection		Activation of NF-kappaB in B cells Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha Cross-presentation of soluble exogenous antigens (endosomes) Autodegradation of Cdh1 by Cdh1:APC/C SCF-beta-TrCP mediated degradation of Emi1 APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Vpu mediated degradation of CD4 Vif-mediated degradation of APOBEC3G SCF(Skp2)-mediated degradation of p27/p21 Degradation of beta-catenin by the destruction complex Downstream TCR signaling Separation of Sister Chromatids FCERI mediated NF-kB activation Autodegradation of the E3 ubiquitin ligase COP1 Regulation of ornithine decarboxylase (ODC) ABC-family proteins mediated transport AUF1 (hnRNP D0) binds and destabilizes mRNA Asymmetric localization of PCP proteins Degradation of AXIN Degradation of DVL Hedgehog ligand biogenesis Hh mutants that don't undergo autocatalytic processing are degraded by ERAD Dectin-1 mediated noncanonical NF-kB signaling CLEC7A (Dectin-1) signaling Degradation of GLI1 by the proteasome GLI3 is processed to GLI3R by the proteasome Hedgehog 'on' state Regulation of RAS by GAPs TNFR2 non-canonical NF-kB pathway NIK-->noncanonical NF-kB signaling Defective CFTR causes cystic fibrosis MAPK6/MAPK4 signaling UCH proteinases Ub-specific processing proteases Neutrophil degranulation CDT1 association with the CDC6:ORC:origin complex Orc1 removal from chromatin CDK-mediated phosphorylation and removal of Cdc6 G2/M Checkpoints Ubiquitin Mediated Degradation of Phosphorylated Cdc25A Ubiquitin-dependent degradation of Cyclin D The role of GTSE1 in G2/M progression after G2 checkpoint FBXL7 down-regulates AURKA during mitotic entry and in early mitosis RUNX1 regulates transcription of genes involved in differentiation of HSCs Regulation of RUNX2 expression and activity Regulation of RUNX3 expression and activity Regulation of PTEN stability and activity Neddylation Interleukin-1 signaling Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER FAILURE, ACUTE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Amyotrophic Lateral Sclerosis	Associate	40033250	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	30670769	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	33525943, 35459186	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	30670769	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	31173190	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	36123629	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	24105791	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Cord Injuries	Associate	17218363	★★★★★ ★☆☆☆☆ Found in Text Mining only

PSMD11 (proteasome 26S subunit, non-ATPase 11)