TRIM54 (tripartite motif containing 54)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57159
Gene name Gene Name - the full gene name approved by the HGNC.
Tripartite motif containing 54
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRIM54
Synonyms (NCBI Gene) Gene synonyms aliases
MURF, MURF-3, RNF30, muRF3
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p23.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for th
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(4)
miRTarBase ID miRNA Experiments Reference
MIRT437475 rno-miR-19b-3p Luciferase reporter assay 24117217
MIRT437475 rno-miR-19b-3p Luciferase reporter assay 24117217
MIRT437476 rno-miR-19a-3p Luciferase reporter assay 24117217
MIRT437476 rno-miR-19a-3p Luciferase reporter assay 24117217
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(19)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 25910212, 29892012, 31391242, 31515488, 32296183, 36217029
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IEA
GO:0005874 Component Microtubule IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
606474 16008 ENSG00000138100
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Q9BYV2
Protein name Tripartite motif-containing protein 54 (Muscle-specific RING finger protein) (MuRF) (Muscle-specific RING finger protein 3) (MuRF-3) (MuRF3) (RING finger protein 30)
Protein function May bind and stabilize microtubules during myotubes formation.
PDB 3Q1D
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13445 zf-RING_UBOX 26 → 79 RING-type zinc-finger Domain
PF00643 zf-B_box 121 → 163 B-box zinc finger Domain
Tissue specificity TISSUE SPECIFICITY: Specifically expressed in heart and skeletal muscle. {ECO:0000269|PubMed:11243782}.
Sequence 
MNFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQASNP
LWQSRGSTTVSSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESSRPLHSKA
EQHLMCEEHEEEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYKRQKSELSDGIAM
LVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFESLCAVLEERKGELLQALAREQE
EKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVELAG
RPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGPEEERPDGP
Sequence length 358
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG  
  Cytoskeleton in muscle cells  
<