Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57144
Gene name Gene Name - the full gene name approved by the HGNC.
P21 (RAC1) activated kinase 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PAK5
Synonyms (NCBI Gene) Gene synonyms aliases
PAK7
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20p12.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the PAK family of Ser/Thr protein kinases. PAK family members are known to be effectors of Rac/Cdc42 GTPases, which have been implicated in the regulation of cytoskeletal dynamics, proliferation, and cell su
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT655461 hsa-miR-138-1-3p HITS-CLIP 23824327
MIRT655460 hsa-miR-627-3p HITS-CLIP 23824327
MIRT655459 hsa-miR-3682-5p HITS-CLIP 23824327
MIRT622932 hsa-miR-129-5p HITS-CLIP 23824327
MIRT622931 hsa-miR-548n HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0001558 Process Regulation of cell growth TAS 20070256
GO:0004672 Function Protein kinase activity IEA
GO:0004674 Function Protein serine/threonine kinase activity IBA
GO:0004674 Function Protein serine/threonine kinase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608038 15916 ENSG00000101349
Protein
UniProt ID Q9P286
Protein name Serine/threonine-protein kinase PAK 5 (EC 2.7.11.1) (p21-activated kinase 5) (PAK-5) (p21-activated kinase 7) (PAK-7)
Protein function Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell migration, proliferation or cell survival. Activation by various effectors including growth factor receptors o
PDB 2F57 , 8C12
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00786 PBD 10 66 P21-Rho-binding domain Domain
PF00069 Pkinase 449 700 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in brain.
Sequence
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAP
MKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHA
EENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEA
YYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTA
GTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFG
ASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS
QSKSGYSSSSHQYPSGYHKATLYHHPSLQSSSQYISTASYLSSLSLSSSTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLANFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYSSYLVGDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFL
KLAGPPSCIVPLMRQYRHH
Sequence length 719
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Human immunodeficiency virus 1 infection
Renal cell carcinoma
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 31987914, 33867848
Carcinogenesis Associate 23106939, 25052921, 25632266, 26682509, 32626960, 33867848, 37480971
Carcinoma Non Small Cell Lung Associate 35242138
Colorectal Neoplasms Associate 20567954, 25052921, 25366420
Esophageal Neoplasms Associate 25436453
Esophageal Squamous Cell Carcinoma Associate 25436453
Glaucoma Associate 21310917
Glaucoma Open Angle Associate 21310917
Glioblastoma Associate 32626960
Glioma Associate 25632266, 31638257