PAK5 (p21 (RAC1) activated kinase 5)

Gene

• Entrez ID: 57144
• Gene name: P21 (RAC1) activated kinase 5
• Gene symbol: PAK5
• Synonyms (NCBI Gene): PAK7
• Chromosome: 20
• Chromosome location: 20p12.2
• Summary: The protein encoded by this gene is a member of the PAK family of Ser/Thr protein kinases. PAK family members are known to be effectors of Rac/Cdc42 GTPases, which have been implicated in the regulation of cytoskeletal dynamics, proliferation, and cell su

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT655461	hsa-miR-138-1-3p	HITS-CLIP	23824327
MIRT655460	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT655459	hsa-miR-3682-5p	HITS-CLIP	23824327
MIRT622932	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT622931	hsa-miR-548n	HITS-CLIP	23824327
MIRT622930	hsa-miR-548l	HITS-CLIP	23824327
MIRT622929	hsa-miR-630	HITS-CLIP	23824327
MIRT622928	hsa-miR-1202	HITS-CLIP	23824327
MIRT622927	hsa-miR-3972	HITS-CLIP	23824327
MIRT622926	hsa-miR-5006-5p	HITS-CLIP	23824327
MIRT622925	hsa-miR-4776-3p	HITS-CLIP	23824327

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001558	Process	Regulation of cell growth	TAS	20070256
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	19060904, 20936779, 25416956, 25910212, 31515488, 32296183, 32707033, 32814053, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	20070256
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007010	Process	Cytoskeleton organization	TAS	20070256
GO:0007165	Process	Signal transduction	TAS	20070256
GO:0007612	Process	Learning	IEA
GO:0007613	Process	Memory	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0008283	Process	Cell population proliferation	TAS	20070256
GO:0009267	Process	Cellular response to starvation	IBA
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	TAS	20070256
GO:0016740	Function	Transferase activity	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0043408	Process	Regulation of MAPK cascade	IBA
GO:0045202	Component	Synapse	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IEA

Other IDs

• MIM: 608038
• HGNC: 15916
• e!Ensembl: ENSG00000101349

Protein

• UniProt ID: Q9P286
• Protein name: Serine/threonine-protein kinase PAK 5 (EC 2.7.11.1) (p21-activated kinase 5) (PAK-5) (p21-activated kinase 7) (PAK-7)
• Protein function: Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell migration, proliferation or cell survival. Activation by various effectors including growth factor receptors o
• PDB: 2F57, 8C12
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00786	PBD	10 → 66	P21-Rho-binding domain	Domain
  PF00069	Pkinase	449 → 700	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in brain.
• Sequence:

  MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
  PIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHA
  EENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEA
  YYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTA
  GTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFG
  ASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS
  QSKSGYSSSSHQYPSGYHKATLYHHPSLQSSSQYISTASYLSSLSLSSSTYPPPSWGSSS
  DQQPSRVSHEQFRAALQLVVSPGDPREYLANFIKIGEGSTGIVCIATEKHTGKQVAVKKM
  DLRKQQRRELLFNEVVIMRDYHHDNVVDMYSSYLVGDELWVVMEFLEGGALTDIVTHTRM
  NEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
  KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
  PRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH

• Sequence length: 719

Pathways

KEGG:

ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Human immunodeficiency virus 1 infection
Renal cell carcinoma