Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	57135
Gene name Gene Name - the full gene name approved by the HGNC.	Deleted in azoospermia 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DAZ4
Synonyms (NCBI Gene) Gene synonyms aliases	pDP1680, pDP1681
Chromosome Chromosome number	Y
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Yq11.23
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important

Show/Hide all(39)

miRTarBase ID	miRNA	Experiments
MIRT923426	hsa-let-7a	CLIP-seq
MIRT923427	hsa-let-7b	CLIP-seq
MIRT923428	hsa-let-7c	CLIP-seq
MIRT923429	hsa-let-7d	CLIP-seq
MIRT923430	hsa-let-7e	CLIP-seq
MIRT923431	hsa-let-7f	CLIP-seq
MIRT923432	hsa-let-7g	CLIP-seq
MIRT923433	hsa-let-7i	CLIP-seq
MIRT923434	hsa-miR-1270	CLIP-seq
MIRT923435	hsa-miR-1304	CLIP-seq
MIRT923436	hsa-miR-202	CLIP-seq
MIRT923437	hsa-miR-203	CLIP-seq
MIRT923438	hsa-miR-3140-3p	CLIP-seq
MIRT923439	hsa-miR-3140-5p	CLIP-seq
MIRT923440	hsa-miR-3682-5p	CLIP-seq
MIRT923441	hsa-miR-3923	CLIP-seq
MIRT923442	hsa-miR-4276	CLIP-seq
MIRT923443	hsa-miR-4302	CLIP-seq
MIRT923444	hsa-miR-432	CLIP-seq
MIRT923445	hsa-miR-4434	CLIP-seq
MIRT923446	hsa-miR-4458	CLIP-seq
MIRT923447	hsa-miR-4500	CLIP-seq
MIRT923448	hsa-miR-4516	CLIP-seq
MIRT923449	hsa-miR-4531	CLIP-seq
MIRT923450	hsa-miR-4766-5p	CLIP-seq
MIRT923451	hsa-miR-4777-5p	CLIP-seq
MIRT923452	hsa-miR-513a-3p	CLIP-seq
MIRT923453	hsa-miR-518d-5p	CLIP-seq
MIRT923454	hsa-miR-519b-5p	CLIP-seq
MIRT923455	hsa-miR-519c-5p	CLIP-seq
MIRT923456	hsa-miR-520c-5p	CLIP-seq
MIRT923457	hsa-miR-526a	CLIP-seq
MIRT923458	hsa-miR-548u	CLIP-seq
MIRT923459	hsa-miR-561	CLIP-seq
MIRT923460	hsa-miR-620	CLIP-seq
MIRT923461	hsa-miR-628-3p	CLIP-seq
MIRT923462	hsa-miR-98	CLIP-seq
MIRT923463	hsa-miR-4733-5p	CLIP-seq
MIRT923464	hsa-miR-606	CLIP-seq

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003730	Function	MRNA 3'-UTR binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	10857750
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0007275	Process	Multicellular organism development	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008494	Function	Translation activator activity	IBA	21873635
GO:0030154	Process	Cell differentiation	IEA
GO:0032991	Component	Protein-containing complex	IDA	10857750
GO:0045948	Process	Positive regulation of translational initiation	IBA	21873635
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IBA	21873635

MIM	HGNC	e!Ensembl
400048	15966	ENSG00000205916

Protein

UniProt ID

Q86SG3

Protein name

Deleted in azoospermia protein 4

Protein function

RNA-binding protein that plays an essential role in spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	42 → 109	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	207 → 274	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF18872	Daz	335 → 355	Daz repeat	Repeat
PF18872	Daz	359 → 379	Daz repeat	Repeat
PF18872	Daz	383 → 403	Daz repeat	Repeat
PF18872	Daz	407 → 427	Daz repeat	Repeat
PF18872	Daz	431 → 451	Daz repeat	Repeat
PF18872	Daz	455 → 475	Daz repeat	Repeat
PF18872	Daz	479 → 499	Daz repeat	Repeat
PF18872	Daz	503 → 523	Daz repeat	Repeat
PF18872	Daz	527 → 547	Daz repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Testis-specific. Expression restricted to premeiotic germ cells, particularly in spermatogonia (at protein level). {ECO:0000269|PubMed:10936047, ECO:0000269|PubMed:18385127, ECO:0000269|PubMed:19223287}.

Sequence

MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCF
GRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLC
ARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQSAANPETPNSTISR
EASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNR
TGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPP
PPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTY
PDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQ
FPVYNYQPFPAYPSSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAY
PNSPVQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPNSAVQVTTGYQ
FHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD

Sequence length

579

Interactions

View interactions

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID
Causal
Cryptorchidism	Cryptorchidism	rs121912555, rs104894697, rs104894698, rs398122886
Non-obstructive azoospermia	Non-obstructive azoospermia	rs587777872, rs879253743, rs1600840291, rs1600877766, rs753462162, rs1588618614, rs1602684496, rs377712900
Oligospermia	Oligospermia	rs1602125411, rs377712900

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining
Arrest of spermatogenesis	Associate	20823911
Infertility	Associate	15520406
Infertility Male	Associate	15744033, 37365340
Oligospermia	Associate	20823911

DAZ4 (deleted in azoospermia 4)