Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57125
Gene name Gene Name - the full gene name approved by the HGNC.
Plexin domain containing 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PLXDC1
Synonyms (NCBI Gene) Gene synonyms aliases
TEM3, TEM7
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q12
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT611370 hsa-miR-4524b-3p HITS-CLIP 19536157
MIRT611369 hsa-miR-5091 HITS-CLIP 19536157
MIRT611368 hsa-miR-5739 HITS-CLIP 19536157
MIRT611367 hsa-miR-4524a-3p HITS-CLIP 19536157
MIRT611370 hsa-miR-4524b-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis NAS 10947988
GO:0005515 Function Protein binding IPI 15574754
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space NAS 15574754
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606826 20945 ENSG00000161381
Protein
UniProt ID Q8IUK5
Protein name Plexin domain-containing protein 1 (Tumor endothelial marker 3) (Tumor endothelial marker 7)
Protein function Plays a critical role in endothelial cell capillary morphogenesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01437 PSI 303 348 Plexin repeat Family
Tissue specificity TISSUE SPECIFICITY: Detected in urine (at protein level) (PubMed:25326458, PubMed:36213313, PubMed:37453717). Detected in endothelial cells from colorectal cancer, and in endothelial cells from primary cancers of the lung, liver, pancreas, breast and brai
Sequence
MRGELWLLVLVLREAARALSPQPGAGHDEGPGSGWAAKGTVRGWNRRARESPGHVSEPDR
TQLSQDLGGGTLAMDTLPDNRTRVVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQVK
IHTILSNTHRQASRVVLSFDFPFYGHPLRQITIATGGFIFMGDVIHRMLTATQYVAPLMA
NFNPGYSDNSTVVYFDNGTVFVVQWDHVYLQGWEDKGSFTFQAALHHDGRIVFAYKEIPM
SVPEISSSQHPVKTGLSDAFMILNPSPDVPESRRRSIFEYHRIELDPSKVTSMSAVEFTP
LPTCLQHRSCDACMSSDLTFNCSWCHVLQRCSSGFDRYRQEWMDYGCAQEAEGRMCEDFQ
DEDHDSASPDTSFSPYDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGDGLQNNLSPKTKGT
PVHLGTIVGIVLAVLLVAAIILAGIYINGHPTSNAALFFIERRPHHWPAMKFRSHPDHST
YAEVEPSGHEKEGFMEAEQC
Sequence length 500
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Asthma Asthma (childhood onset) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Renal Cell Associate 27173324
Chronic Kidney Disease Mineral and Bone Disorder Associate 25231882
Colorectal Neoplasms Associate 15761964
Death Associate 29664548
Glioma Associate 27334625
Neoplasm Metastasis Associate 17560052
Neoplasms Associate 15761964, 17560052, 19440709
Osteosarcoma Associate 17560052, 20032373
Ovarian Neoplasms Associate 29664548
Tachycardia Atrioventricular Nodal Reentry Associate 15761964