Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57120
Gene name Gene Name - the full gene name approved by the HGNC.
Golgi associated PDZ and coiled-coil motif containing
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GOPC
Synonyms (NCBI Gene) Gene synonyms aliases
CAL, FIG, GOPC1, PIST, dJ94G16.2
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a Golgi protein with a PDZ domain. The PDZ domain is globular and proteins which contain them bind other proteins through short motifs near the C-termini. Mice which are deficient in the orthologous protein have globozoospermia and are i
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020115 hsa-miR-130b-3p Sequencing 20371350
MIRT027025 hsa-miR-103a-3p Sequencing 20371350
MIRT1027357 hsa-miR-140-3p CLIP-seq
MIRT1027358 hsa-miR-219-2-3p CLIP-seq
MIRT1027359 hsa-miR-23a CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0005515 Function Protein binding IPI 11384996, 11707463, 12471024, 19027007, 20195357, 25416956, 25609649, 26179146, 29892012, 31515488
GO:0005737 Component Cytoplasm IDA 11707463
GO:0005765 Component Lysosomal membrane TAS
GO:0005794 Component Golgi apparatus IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606845 17643 ENSG00000047932
Protein
UniProt ID Q9HD26
Protein name Golgi-associated PDZ and coiled-coil motif-containing protein (CFTR-associated ligand) (Fused in glioblastoma) (PDZ protein interacting specifically with TC10) (PIST)
Protein function Plays a role in intracellular protein trafficking and degradation (PubMed:11707463, PubMed:14570915, PubMed:15358775). May regulate CFTR chloride currents and acid-induced ASIC3 currents by modulating cell surface expression of both channels (By
PDB 2DC2 , 2LOB , 4E34 , 4E35 , 4JOE , 4JOF , 4JOG , 4JOH , 4JOJ , 4JOK , 4JOP , 4JOR , 4K6Y , 4K72 , 4K75 , 4K76 , 4K78 , 4NMO , 4NMP , 4NMQ , 4NMR , 4NMS , 4NMT , 4NMV , 4Q6H , 4Q6S , 5IC3 , 5K4F , 6OV7 , 6V84 , 6XNJ , 7JZO , 7JZP , 7JZQ , 7JZR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00595 PDZ 288 368 PDZ domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:11162552, ECO:0000269|PubMed:11384996, ECO:0000269|PubMed:11707463}.
Sequence
MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQA
DITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVH
DQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVK
LLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQL
EAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLG
ISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQR
GEIEFEVV
YVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQG
FNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY
Sequence length 462
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    RHO GTPases regulate CFTR trafficking
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Atrial fibrillation Atrial Fibrillation rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557
View all (6 more)
29892015
Male infertility Male infertility due to globozoospermia rs554675432, rs9332971, rs397507505, rs797045116, rs748618094, rs781431741, rs1555979575, rs377581367
Melanoma melanoma rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340
View all (64 more)
22535842
Unknown
Disease term Disease name Evidence References Source
Paroxysmal atrial fibrillation Paroxysmal atrial fibrillation 29892015 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 34252349
Adenocarcinoma of Lung Associate 23052255
Cystic Fibrosis Associate 33314931
Glioma Associate 23052255, 28912153, 31995621
Lung Neoplasms Associate 23052255
Neoplasms Associate 28912153, 31995621, 33414136, 34599262
Ovarian Neoplasms Associate 32652753
Teratozoospermia Associate 20562896