Gene Gene information from NCBI Gene database.
Entrez ID 57120
Gene name Golgi associated PDZ and coiled-coil motif containing
Gene symbol GOPC
Synonyms (NCBI Gene)
CALFIGGOPC1PISTdJ94G16.2
Chromosome 6
Chromosome location 6q22.1
Summary This gene encodes a Golgi protein with a PDZ domain. The PDZ domain is globular and proteins which contain them bind other proteins through short motifs near the C-termini. Mice which are deficient in the orthologous protein have globozoospermia and are i
miRNA miRNA information provided by mirtarbase database.
323
miRTarBase ID miRNA Experiments Reference
MIRT020115 hsa-miR-130b-3p Sequencing 20371350
MIRT027025 hsa-miR-103a-3p Sequencing 20371350
MIRT1027357 hsa-miR-140-3p CLIP-seq
MIRT1027358 hsa-miR-219-2-3p CLIP-seq
MIRT1027359 hsa-miR-23a CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
35
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0005515 Function Protein binding IPI 11384996, 11707463, 12471024, 19027007, 20195357, 23818989, 25416956, 25609649, 26179146, 28360110, 28514442, 29892012, 31324722, 31515488, 32296183, 33961781, 36012204
GO:0005737 Component Cytoplasm IDA 11707463
GO:0005737 Component Cytoplasm IEA
GO:0005765 Component Lysosomal membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606845 17643 ENSG00000047932
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9HD26
Protein name Golgi-associated PDZ and coiled-coil motif-containing protein (CFTR-associated ligand) (Fused in glioblastoma) (PDZ protein interacting specifically with TC10) (PIST)
Protein function Plays a role in intracellular protein trafficking and degradation (PubMed:11707463, PubMed:14570915, PubMed:15358775). May regulate CFTR chloride currents and acid-induced ASIC3 currents by modulating cell surface expression of both channels (By
PDB 2DC2 , 2LOB , 4E34 , 4E35 , 4JOE , 4JOF , 4JOG , 4JOH , 4JOJ , 4JOK , 4JOP , 4JOR , 4K6Y , 4K72 , 4K75 , 4K76 , 4K78 , 4NMO , 4NMP , 4NMQ , 4NMR , 4NMS , 4NMT , 4NMV , 4Q6H , 4Q6S , 5IC3 , 5K4F , 6OV7 , 6V84 , 6XNJ , 7JZO , 7JZP , 7JZQ , 7JZR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00595 PDZ 288 368 PDZ domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:11162552, ECO:0000269|PubMed:11384996, ECO:0000269|PubMed:11707463}.
Sequence
MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQA
DITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVH
DQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVK
LLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQL
EAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLG
ISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQR
GEIEFEVV
YVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQG
FNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY
Sequence length 462
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    RHO GTPases regulate CFTR trafficking