Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	57115
Gene name	Peptidoglycan recognition protein 4
Gene symbol	PGLYRP4
Synonyms (NCBI Gene)	PGLYRPIbetaPGRP-IbetaPGRPIBSBBI67
Chromosome	1
Chromosome location	1q21.3
Summary	Summary: This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. These proteins are part of the innate immune system and recognize peptidoglycan, a ubiquitous component of bacterial cell wal

Show/Hide all (40)

miRTarBase ID	miRNA	Experiments
MIRT1227529	hsa-miR-1207-5p	CLIP-seq
MIRT1227530	hsa-miR-1273d	CLIP-seq
MIRT1227531	hsa-miR-147	CLIP-seq
MIRT1227532	hsa-miR-1909	CLIP-seq
MIRT1227533	hsa-miR-199a-3p	CLIP-seq
MIRT1227534	hsa-miR-199b-3p	CLIP-seq
MIRT1227535	hsa-miR-3129-5p	CLIP-seq
MIRT1227536	hsa-miR-3616-3p	CLIP-seq
MIRT1227537	hsa-miR-3688-5p	CLIP-seq
MIRT1227538	hsa-miR-3911	CLIP-seq
MIRT1227539	hsa-miR-451b	CLIP-seq
MIRT1227540	hsa-miR-4736	CLIP-seq
MIRT1227541	hsa-miR-4763-3p	CLIP-seq
MIRT1227542	hsa-miR-4779	CLIP-seq
MIRT1227543	hsa-miR-644	CLIP-seq
MIRT1227544	hsa-miR-660	CLIP-seq
MIRT1227545	hsa-miR-765	CLIP-seq
MIRT1227546	hsa-miR-892a	CLIP-seq
MIRT1227547	hsa-miR-936	CLIP-seq
MIRT1227531	hsa-miR-147	CLIP-seq
MIRT1227537	hsa-miR-3688-5p	CLIP-seq
MIRT1227538	hsa-miR-3911	CLIP-seq
MIRT1227543	hsa-miR-644	CLIP-seq
MIRT1227546	hsa-miR-892a	CLIP-seq
MIRT2294175	hsa-miR-378	CLIP-seq
MIRT2294176	hsa-miR-378b	CLIP-seq
MIRT2294177	hsa-miR-378c	CLIP-seq
MIRT2294178	hsa-miR-378d	CLIP-seq
MIRT2294179	hsa-miR-378e	CLIP-seq
MIRT2294180	hsa-miR-378f	CLIP-seq
MIRT2294181	hsa-miR-378h	CLIP-seq
MIRT2294182	hsa-miR-378i	CLIP-seq
MIRT2294183	hsa-miR-422a	CLIP-seq
MIRT2294184	hsa-miR-4257	CLIP-seq
MIRT2294185	hsa-miR-4446-3p	CLIP-seq
MIRT2294186	hsa-miR-4494	CLIP-seq
MIRT2294187	hsa-miR-4675	CLIP-seq
MIRT2294188	hsa-miR-4721	CLIP-seq
MIRT2294189	hsa-miR-4741	CLIP-seq
MIRT2294190	hsa-miR-499a-5p	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0006955	Process	Immune response	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008745	Function	N-acetylmuramoyl-L-alanine amidase activity	IEA
GO:0009253	Process	Peptidoglycan catabolic process	IEA
GO:0016019	Function	Peptidoglycan immune receptor activity	IDA	11461926
GO:0016019	Function	Peptidoglycan immune receptor activity	IEA
GO:0016020	Component	Membrane	NAS	11461926
GO:0016045	Process	Detection of bacterium	IDA	11461926
GO:0016045	Process	Detection of bacterium	IEA
GO:0031640	Process	Killing of cells of another organism	IDA	16354652
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0032991	Component	Protein-containing complex	IDA	16354652
GO:0042742	Process	Defense response to bacterium	IBA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042834	Function	Peptidoglycan binding	IDA	11461926, 16354652, 17502600
GO:0042834	Function	Peptidoglycan binding	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	NAS	11461926
GO:0046982	Function	Protein heterodimerization activity	IPI	16354652
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	11461926, 16354652
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	16354652
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IEA

MIM	HGNC	e!Ensembl
608198	30015	ENSG00000163218

Q96LB8

Protein name

Peptidoglycan recognition protein 4 (Peptidoglycan recognition protein I-beta) (PGLYRPIbeta) (PGRP-I-beta) (Peptidoglycan recognition protein intermediate beta)

Protein function

Pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria. Has bactericidal activity towards Gram-positive bacteria. May kill Gram-positive bacteria by interfering with peptidoglycan biosynthesis. Also binds to Gram-ne

PDB

2EAV , 2EAX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01510	Amidase_2	73 → 213	N-acetylmuramoyl-L-alanine amidase	Domain
PF01510	Amidase_2	229 → 359	N-acetylmuramoyl-L-alanine amidase	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in skin epidermis, eccrine sweat glands and ducts, mucous cells in the submandibular salivary gland, mucous cells in the throat, ciliary body epithelial cells of the eye, small intestine, colon, stomach and in mature epithelia

Sequence

MLPWLLVFSALGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKA
WGAEAVGCSIQLTTPVNVLVIHHVPGLECHDQTVCSQRLRELQAHHVHNNSGCDVAYNFL
VGDDGRVYEGVGWNIQGVHTQGYNNISLGFAFFGTKKGHSPSPAALSAMENLITYAVQKG
HLSSSYVQPLLGKGENCLAPRQKTSLKKACPGVVPRSVWGARETHCPRMTLPAKYGIIIH
TAGRTCNISDECRLLVRDIQSFYIDRLKSCDIGYNFLVGQDGAIYEGVGWNVQGSSTPGY
DDIALGITFMGTFTGIPPNAAALEAAQDLIQCAMVKGYLTPNYLLVGHSDVARTLSPGQA
LYNIISTWPHFKH

Sequence length

373

Interactions

View interactions

	Reactome
			Antimicrobial peptides

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Ovarian Neoplasms	Associate	30786925	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	24838182	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	38157249	★★★★★ ★☆☆☆☆ Found in Text Mining only

PGLYRP4 (peptidoglycan recognition protein 4)