TRPC7 (transient receptor potential cation channel subfamily C member 7)

Gene

• Entrez ID: 57113
• Gene name: Transient receptor potential cation channel subfamily C member 7
• Gene symbol: TRPC7
• Synonyms (NCBI Gene): TRP7
• Chromosome: 5
• Chromosome location: 5q31.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029163	hsa-miR-26b-5p	Microarray	19088304
MIRT1457288	hsa-miR-138	CLIP-seq
MIRT1457289	hsa-miR-224	CLIP-seq
MIRT1457290	hsa-miR-3529	CLIP-seq
MIRT1457291	hsa-miR-379	CLIP-seq
MIRT1457292	hsa-miR-4451	CLIP-seq
MIRT1457293	hsa-miR-4650-3p	CLIP-seq
MIRT2462418	hsa-miR-1587	CLIP-seq
MIRT2462419	hsa-miR-299-3p	CLIP-seq
MIRT2462420	hsa-miR-4265	CLIP-seq
MIRT2462421	hsa-miR-4296	CLIP-seq
MIRT2462422	hsa-miR-4322	CLIP-seq
MIRT2462423	hsa-miR-4417	CLIP-seq
MIRT2462424	hsa-miR-4492	CLIP-seq
MIRT2462425	hsa-miR-4498	CLIP-seq
MIRT2462426	hsa-miR-4656	CLIP-seq
MIRT2462427	hsa-miR-4675	CLIP-seq
MIRT2462428	hsa-miR-4741	CLIP-seq
MIRT2462429	hsa-miR-762	CLIP-seq
MIRT2462418	hsa-miR-1587	CLIP-seq
MIRT2462419	hsa-miR-299-3p	CLIP-seq
MIRT2462420	hsa-miR-4265	CLIP-seq
MIRT2462421	hsa-miR-4296	CLIP-seq
MIRT2462422	hsa-miR-4322	CLIP-seq
MIRT2462423	hsa-miR-4417	CLIP-seq
MIRT2462424	hsa-miR-4492	CLIP-seq
MIRT2462425	hsa-miR-4498	CLIP-seq
MIRT2462426	hsa-miR-4656	CLIP-seq
MIRT2462427	hsa-miR-4675	CLIP-seq
MIRT2462428	hsa-miR-4741	CLIP-seq
MIRT2462429	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005262	Function	Calcium channel activity	IEA
GO:0005262	Function	Calcium channel activity	TAS
GO:0005515	Function	Protein binding	IPI	21402151
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006828	Process	Manganese ion transport	IEA
GO:0007338	Process	Single fertilization	IBA
GO:0015279	Function	Store-operated calcium channel activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034703	Component	Cation channel complex	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IBA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IBA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	TAS
GO:0070679	Function	Inositol 1,4,5 trisphosphate binding	IBA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9HCX4
• Protein name: Short transient receptor potential channel 7 (TrpC7) (Transient receptor protein 7) (TRP-7) (hTRP7)
• Protein function: Forms a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Activated by diacylglycerol (
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12796	Ank_2	47 → 139	Ankyrin repeats (3 copies)	Repeat
  PF08344	TRP_2	198 → 260	Transient receptor ion channel II	Family
  PF00520	Ion_trans	386 → 684	Ion transport protein	Family

• Sequence:

  MLRNSTFKNMQRRHTTLREKGRRQAIRGPAYMFNEKGTSLTPEEERFLDSAEYGNIPVVR
  KMLEESKTLNFNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVR
  IVEAILNHPAFAQGQRLTLSPLEQELRDDDFYAYDEDGTRFSHDITPIILAAHCQEYEIV
  HILLLKGARIERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGLASAAYLSLSSEDPVL
  TALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDVNFQVW
  SDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSIAVKFLAVFGVSI
  GLPFLAIAYWIAPCSKLGRTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFEGVKTLPNET
  FTDYPKQIFRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEEGPREYVLHLWNLLDFGMLS
  IFVASFTARFMAFLKATEAQLYVDQHVQDDTLHNVSLPPEVAYFTYARDKWWPSDPQIIS
  EGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNL
  YSYYRGAKYNPAFTTVEESFKTLFWSIFGLSEVISVVLKYDHKFIENIGYVLYGVYNVTM
  VVVLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPAPFNLVPSPKSFYY
  LIMRIKMCLIKLCKSKAKSCENDLEMGMLNSKFKKTRYQAGMRNSENLTANNTLSKPTRY
  QKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQ
  LSEKFGKNLNKDHLRVNKGKDI

• Sequence length: 862

Pathways

Reactome:

Effects of PIP2 hydrolysis
Elevation of cytosolic Ca2+ levels
TRP channels

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE ACUTE RESPIRATORY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Atrial Fibrillation	Associate	28839241	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	38320625	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Associate	31881747	★☆☆☆☆ Found in Text Mining only
Kabuki syndrome	Associate	33674768	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	30786925	★☆☆☆☆ Found in Text Mining only